TL1A/TNFSF15 Antibody

Images

 
Immunohistochemistry-Paraffin: TL1A/TNFSF15 Antibody [NBP1-82755] - Staining of human esophagus shows strong membranous positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TL1A/TNFSF15 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNFSF15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TL1A/TNFSF15 Protein (NBP1-82755PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TL1A/TNFSF15 Antibody

  • MGC129934
  • MGC129935
  • TL1A
  • TL1Vascular endothelial cell growth inhibitor
  • TNF superfamily ligand TL1A
  • TNFSF15
  • tumor necrosis factor (ligand) superfamily, member 15
  • tumor necrosis factor ligand superfamily member 15
  • vascular endothelial growth inhibitor-192A
  • VEGI
  • VEGI192A
  • VEGITNF ligand-related molecule 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-56169
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc

Publications for TL1A/TNFSF15 Antibody (NBP1-82755) (0)

There are no publications for TL1A/TNFSF15 Antibody (NBP1-82755).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TL1A/TNFSF15 Antibody (NBP1-82755) (0)

There are no reviews for TL1A/TNFSF15 Antibody (NBP1-82755). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TL1A/TNFSF15 Antibody (NBP1-82755) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TL1A/TNFSF15 Products

Bioinformatics Tool for TL1A/TNFSF15 Antibody (NBP1-82755)

Discover related pathways, diseases and genes to TL1A/TNFSF15 Antibody (NBP1-82755). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TL1A/TNFSF15 Antibody (NBP1-82755)

Discover more about diseases related to TL1A/TNFSF15 Antibody (NBP1-82755).
 

Pathways for TL1A/TNFSF15 Antibody (NBP1-82755)

View related products by pathway.

PTMs for TL1A/TNFSF15 Antibody (NBP1-82755)

Learn more about PTMs related to TL1A/TNFSF15 Antibody (NBP1-82755).
 

Research Areas for TL1A/TNFSF15 Antibody (NBP1-82755)

Find related products by research area.

Blogs on TL1A/TNFSF15

There are no specific blogs for TL1A/TNFSF15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TL1A/TNFSF15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFSF15
Entrez