TKTL1 Antibody


Western Blot: TKTL1 Antibody [NBP1-54864] - Human Fetal Stomach Cell Lysate, concentration 1 ug/ml.
Immunohistochemistry-Paraffin: TKTL1 Antibody [NBP1-54864] - Human Testis Tissue, 5.0ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

TKTL1 Antibody Summary

Synthetic peptides corresponding to TKTL1(transketolase-like 1) The peptide sequence was selected from the middle region of TKTL1. Peptide sequence QIQTSRNLDPQPPIEDSPEVNITDVRMTSPPDYRVGDKIATRKACGLALA.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against TKTL1 and was validated on Western blot.
Theoretical MW
65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TKTL1 Antibody

  • TK 2
  • TKR EC
  • TKR
  • TKT2Transketolase 2
  • transketolase-2
  • transketolase-like 1
  • transketolase-like protein 1
  • Transketolase-related protein


Strong TKTL1 protein expression has been correlated with a certain type of glucose metabolism (aerobic glycolysis; Warburg effect) and to cells which are affected by chronic complications of diabetic patients. In colon and urothelial carcinomas, expression at the protein level is correlated with invasiveness of tumors and poor patient survival.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TKTL1 Antibody (NBP1-54864) (0)

There are no publications for TKTL1 Antibody (NBP1-54864).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TKTL1 Antibody (NBP1-54864) (0)

There are no reviews for TKTL1 Antibody (NBP1-54864). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TKTL1 Antibody (NBP1-54864) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TKTL1 Products

Bioinformatics Tool for TKTL1 Antibody (NBP1-54864)

Discover related pathways, diseases and genes to TKTL1 Antibody (NBP1-54864). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TKTL1 Antibody (NBP1-54864)

Discover more about diseases related to TKTL1 Antibody (NBP1-54864).

Pathways for TKTL1 Antibody (NBP1-54864)

View related products by pathway.

PTMs for TKTL1 Antibody (NBP1-54864)

Learn more about PTMs related to TKTL1 Antibody (NBP1-54864).

Blogs on TKTL1

There are no specific blogs for TKTL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TKTL1 Antibody and receive a gift card or discount.


Gene Symbol TKTL1