TIN2 Antibody

Images

 
Western Blot: TIN2 Antibody [NBP2-55709] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Immunocytochemistry/ Immunofluorescence: TIN2 Antibody [NBP2-55709] - Staining of human cell line U-2 OS shows localization to nuclear bodies.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TIN2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FEYLCQLEKALPTPQAQQLQDVLSWMQPGVSITSSLAWRQYGVDMGWLLPECSVTDSVNLAEPMEQNPPQQQRL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TINF2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TIN2 Recombinant Protein Antigen (NBP2-55709PEP)
Publications
Read Publications using NBP2-55709.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TIN2 Antibody

  • (TRF1)-interacting nuclear factor 2 variant 1
  • TERF1 (TRF1)-interacting nuclear factor 2
  • TERF1-interacting nuclear factor 2
  • TIN2TRF1-interacting nuclear protein 2

Background

TIN2 is a component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends; without its protective

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-57130
Species: ChHa, Hu, Mu, Pm, Rt
Applications: ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NB110-68281
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF (-), Simple Western, WB
H00065057-M02
Species: Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-292
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB500-176
Species: Hu
Applications: WB
NBP2-48820
Species: Hu
Applications: IHC, IHC-P
NB100-317
Species: Hu, Mu, Rt
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-14870
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-22527
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PLA, WB
NBP1-49938
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
AF6797
Species: Hu
Applications: WB
NBP1-85156
Species: Hu
Applications: IHC, IHC-P, WB
AF7116
Species: Hu
Applications: WB
NBP2-32441
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13656
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-22360
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP1-90029
Species: Hu
Applications: IHC, IHC-P, WB

Publications for TIN2 Antibody (NBP2-55709)(2)

Reviews for TIN2 Antibody (NBP2-55709) (0)

There are no reviews for TIN2 Antibody (NBP2-55709). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TIN2 Antibody (NBP2-55709) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TIN2 Products

Bioinformatics Tool for TIN2 Antibody (NBP2-55709)

Discover related pathways, diseases and genes to TIN2 Antibody (NBP2-55709). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIN2 Antibody (NBP2-55709)

Discover more about diseases related to TIN2 Antibody (NBP2-55709).
 

Pathways for TIN2 Antibody (NBP2-55709)

View related products by pathway.

PTMs for TIN2 Antibody (NBP2-55709)

Learn more about PTMs related to TIN2 Antibody (NBP2-55709).

Blogs on TIN2

There are no specific blogs for TIN2, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIN2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TINF2