DKC1 Antibody

Images

 
Western Blot: DKC1 Antibody [NBP1-85156] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human cell line A-431 Lane 5: Human liver tissue Lane ...read more
Immunohistochemistry-Paraffin: DKC1 Antibody [NBP1-85156] - Staining of human cerebral cortex shows strong nucleolar positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DKC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EAGTYIRTLCVHLGLLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLVMKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVIT
Specificity
Specificity of human DKC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DKC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, Retrieval method: HIER pH6.
Control Peptide
DKC1 Protein (NBP1-85156PEP)
Publications
Read Publications using NBP1-85156.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DKC1 Antibody

  • CBF5 homolog
  • CBF5
  • cbf5p homolog
  • DKC
  • dyskeratosis congenita 1, dyskerin
  • Dyskerin
  • EC 5.4.99
  • EC 5.4.99.-
  • FLJ97620
  • H/ACA ribonucleoprotein complex subunit 4
  • NAP57
  • NOLA4dyskerin
  • Nopp140-associated protein of 57 kDa
  • Nucleolar protein family A member 4
  • Nucleolar protein NAP57
  • snoRNP protein DKC1
  • XAP101

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-317
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, ChIP
NBP2-32441
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13656
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-31742
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55709
Species: Hu
Applications: WB, ICC/IF
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-89306
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD
NBP1-92388
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-68252
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KO
H00004354-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
NBP1-81680
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77306
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-83837
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for DKC1 Antibody (NBP1-85156)(4)

Reviews for DKC1 Antibody (NBP1-85156) (0)

There are no reviews for DKC1 Antibody (NBP1-85156). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DKC1 Antibody (NBP1-85156) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DKC1 Products

Bioinformatics Tool for DKC1 Antibody (NBP1-85156)

Discover related pathways, diseases and genes to DKC1 Antibody (NBP1-85156). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DKC1 Antibody (NBP1-85156)

Discover more about diseases related to DKC1 Antibody (NBP1-85156).
 

Pathways for DKC1 Antibody (NBP1-85156)

View related products by pathway.

PTMs for DKC1 Antibody (NBP1-85156)

Learn more about PTMs related to DKC1 Antibody (NBP1-85156).

Blogs on DKC1

There are no specific blogs for DKC1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DKC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DKC1