PAK1 interacting protein 1 Antibody


Western Blot: PAK1 interacting protein 1 Antibody [NBP1-90029] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: PAK1 interacting protein 1 Antibody [NBP1-90029] - Staining of human colon shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

PAK1 interacting protein 1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: VWLDKVADMKESLPPAAEPSPVSKEQSKIGKKEPGDTVHKEEKRSKPNTKKRGLTGDSKKATKES
Specificity of human PAK1 interacting protein 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PAK1 interacting protein 1 Protein (NBP1-90029PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PAK1 interacting protein 1 Antibody

  • bA421M1.5
  • FLJ20624
  • hPIP1WD repeat-containing protein 84
  • MAK11
  • p21-activated protein kinase-interacting protein 1
  • PAK1 interacting protein 1
  • PIP1PAK/PLC-interacting protein 1
  • RP11-421M1.5
  • WDR84PAK1-interacting protein 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, GS, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, Simple Western, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: ICC/IF (-), WB, Simple Western, ELISA, Flow
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for PAK1 interacting protein 1 Antibody (NBP1-90029) (0)

There are no publications for PAK1 interacting protein 1 Antibody (NBP1-90029).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAK1 interacting protein 1 Antibody (NBP1-90029) (0)

There are no reviews for PAK1 interacting protein 1 Antibody (NBP1-90029). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PAK1 interacting protein 1 Antibody (NBP1-90029) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PAK1 interacting protein 1 Products

Bioinformatics Tool for PAK1 interacting protein 1 Antibody (NBP1-90029)

Discover related pathways, diseases and genes to PAK1 interacting protein 1 Antibody (NBP1-90029). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PAK1 interacting protein 1 Antibody (NBP1-90029)

Discover more about diseases related to PAK1 interacting protein 1 Antibody (NBP1-90029).

Pathways for PAK1 interacting protein 1 Antibody (NBP1-90029)

View related products by pathway.

PTMs for PAK1 interacting protein 1 Antibody (NBP1-90029)

Learn more about PTMs related to PAK1 interacting protein 1 Antibody (NBP1-90029).

Blogs on PAK1 interacting protein 1

There are no specific blogs for PAK1 interacting protein 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PAK1 interacting protein 1 Antibody and receive a gift card or discount.


Gene Symbol PAK1IP1