Western Blot: PAK1 interacting protein 1 Antibody [NBP1-90029] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: PAK1 interacting protein 1 Antibody [NBP1-90029] - Staining of human colon shows strong cytoplasmic and nuclear positivity in glandular cells.
This antibody was developed against Recombinant Protein corresponding to amino acids: VWLDKVADMKESLPPAAEPSPVSKEQSKIGKKEPGDTVHKEEKRSKPNTKKRGLTGDSKKATKES
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAK1IP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for PAK1 interacting protein 1 Antibody
bA421M1.5
FLJ20624
hPIP1WD repeat-containing protein 84
MAK11
p21-activated protein kinase-interacting protein 1
PAK1 interacting protein 1
PIP1PAK/PLC-interacting protein 1
RP11-421M1.5
WDR84PAK1-interacting protein 1
Background
PIP1/WDR84 (PAK1IP1) was identified as a p21-activated protein kinase (PAK) interacting protein that functions as a negative regulator of PAK activity and PAK signaling pathways. PIP1/WDR84 (PAK1IP1) contains 5 G beta-like WD repeats. The WD repeat is defined by four or more repeating units of a conserved core of approximately 40 amino acids ending with tryptophan-aspartic acid (WD). WD repeats may serve as sites of protein-protein interaction for adaptor proteins and facilitate multiprotein complex formation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Publications for PAK1 interacting protein 1 Antibody (NBP1-90029)(1)
We have publications tested in 1 confirmed species: Human.
We have publications tested in 1 application: IHC.
Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publication 1 - 1 of 1.
Publication using NBP1-90029
Applications
Species
Zhang J, He M, Feng W et al. Identification of Prognostic Biomarkers of Ewing Sarcoma using Bioinformatics Analysis and Experiments Research Square 2021-02-01 (IHC, Human)
IHC
Human
Reviews for PAK1 interacting protein 1 Antibody (NBP1-90029) (0)
There are no reviews for PAK1 interacting protein 1 Antibody (NBP1-90029).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Bioinformatics Tool for PAK1 interacting protein 1 Antibody (NBP1-90029)
Discover related pathways, diseases and genes to PAK1 interacting protein 1 Antibody (NBP1-90029). Need help?
Read the Bioinformatics Tool Guide for instructions on using this tool.
Diseases for PAK1 interacting protein 1 Antibody (NBP1-90029)
Discover more about diseases related to PAK1 interacting protein 1 Antibody (NBP1-90029).
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our PAK1 interacting protein 1 Antibody and receive a gift card or discount.