NHP2 Antibody


Western Blot: NHP2 Antibody [NBP2-13656] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: NHP2 Antibody [NBP2-13656] - Staining in human fallopian tube and pancreas tissues using anti-NHP2 antibody. Corresponding NHP2 RNA-seq data are presented for the same tissues.
Western Blot: NHP2 Antibody [NBP2-13656] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: NHP2 Antibody [NBP2-13656] - Staining of human esophagus shows nucleolar positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: NHP2 Antibody [NBP2-13656] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: NHP2 Antibody [NBP2-13656] - Staining of human pancreas shows low expression as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

NHP2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVK PHEEYQEAYDECLEEVQSLP
Specificity of human NHP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (93%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NHP2 Protein (NBP2-13656PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NHP2 Antibody

  • FLJ20479
  • H/ACA ribonucleoprotein complex subunit 2
  • NHP2 ribonucleoprotein homolog (yeast)
  • NHP2-like protein
  • NHP2P
  • NOLA2member 2 (H/ACA small nucleolar RNPs)
  • Nucleolar protein family A member 2
  • snoRNP protein NHP2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Rt
Applications: WB
Species: Hu, Mu
Applications: WB, GS, ICC/IF
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KO
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC
Species: Hu
Applications: WB, IP, PLA
Species: Hu
Applications: IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for NHP2 Antibody (NBP2-13656) (0)

There are no publications for NHP2 Antibody (NBP2-13656).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NHP2 Antibody (NBP2-13656) (0)

There are no reviews for NHP2 Antibody (NBP2-13656). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NHP2 Antibody (NBP2-13656) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NHP2 Products

Bioinformatics Tool for NHP2 Antibody (NBP2-13656)

Discover related pathways, diseases and genes to NHP2 Antibody (NBP2-13656). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NHP2 Antibody (NBP2-13656)

Discover more about diseases related to NHP2 Antibody (NBP2-13656).

Pathways for NHP2 Antibody (NBP2-13656)

View related products by pathway.

PTMs for NHP2 Antibody (NBP2-13656)

Learn more about PTMs related to NHP2 Antibody (NBP2-13656).

Research Areas for NHP2 Antibody (NBP2-13656)

Find related products by research area.

Blogs on NHP2

There are no specific blogs for NHP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NHP2 Antibody and receive a gift card or discount.


Gene Symbol NHP2