CCDC6 Antibody

Images

 
Western Blot: CCDC6 Antibody [NBP1-85351] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: CCDC6 Antibody [NBP1-85351] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human liver.
Western Blot: CCDC6 Antibody [NBP1-85351] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human skeletal muscle shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining in human fallopian tube and skeletal muscle tissues using anti-CCDC6 antibody. Corresponding CCDC6 RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human colon, fallopian tube, liver and testis using Anti-CCDC6 antibody NBP1-85351 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human testis.
Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human colon.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCDC6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FKKIQALQKEKETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRREKI
Specificity
Specificity of human CCDC6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control
CCDC6 Knockout HeLa Cell Lysate
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCDC6 Antibody

  • coiled-coil domain containing 6
  • D10S170Protein H4
  • H4DNA segment on chromosome 10 (unique) 170
  • Papillary thyroid carcinoma-encoded protein
  • PTCFLJ32286
  • TPCcoiled-coil domain-containing protein 6
  • TST1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58095
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
AF482
Species: Mu
Applications: WB, IHC
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-03993
Species: Hu, Mu, Bv, Ca, Pm
Applications: WB
NBP1-71662
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-48588
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57016
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, GP, Rb
Applications: WB
H00008031-M05
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for CCDC6 Antibody (NBP1-85351) (0)

There are no publications for CCDC6 Antibody (NBP1-85351).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC6 Antibody (NBP1-85351) (0)

There are no reviews for CCDC6 Antibody (NBP1-85351). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CCDC6 Antibody (NBP1-85351) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CCDC6 Products

Bioinformatics Tool for CCDC6 Antibody (NBP1-85351)

Discover related pathways, diseases and genes to CCDC6 Antibody (NBP1-85351). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC6 Antibody (NBP1-85351)

Discover more about diseases related to CCDC6 Antibody (NBP1-85351).
 

Pathways for CCDC6 Antibody (NBP1-85351)

View related products by pathway.

PTMs for CCDC6 Antibody (NBP1-85351)

Learn more about PTMs related to CCDC6 Antibody (NBP1-85351).

Blogs on CCDC6.

The role of Smoothened in pulmonary pathologies
The Hedgehog (Hh) family of secreted proteins is involved in a number of developmental processes, one of which is the development of cancer. Past data suggests that the Sonic hedgehog (Shh) receptor is composed of two transmembrane proteins, Patche...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC6