Recombinant Human TIF1 alpha Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TIF1 alpha Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 432-569 of Human TIF1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:PQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQRQQVQRRPAPVGLPNPRMQGPIQQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRYPPNQNIPRQAIKPNPLQMAFLAQQAIKQW

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TRIM24

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TIF1 alpha Protein

  • E3 ubiquitin-protein ligase TRIM24
  • EC 6.3.2
  • EC 6.3.2.-
  • hTIF1
  • PTC6
  • RING finger protein 82
  • RNF82Tif1a
  • TIF1-alpha
  • TIF1ATIF1ALPHA
  • TIF1TF1A
  • transcription intermediary factor 1-alpha
  • transcriptional intermediary factor 1
  • tripartite motif containing 24
  • tripartite motif-containing 24
  • Tripartite motif-containing protein 24

Background

TRIM24 - transcriptional intermediary factor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2350
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NBP2-13674
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00051592-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB110-40623
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA
NBP2-27562
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-49156
Species: Hu
Applications: ICC/IF, IHC
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00023316-M03
Species: Hu
Applications: WB, ELISA
H00005956-R02
Species: Hu
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00008805-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for TIF1 alpha Partial Recombinant Protein (H00008805-Q01) (0)

There are no publications for TIF1 alpha Partial Recombinant Protein (H00008805-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIF1 alpha Partial Recombinant Protein (H00008805-Q01) (0)

There are no reviews for TIF1 alpha Partial Recombinant Protein (H00008805-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TIF1 alpha Partial Recombinant Protein (H00008805-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TIF1 alpha Products

Bioinformatics Tool for TIF1 alpha Partial Recombinant Protein (H00008805-Q01)

Discover related pathways, diseases and genes to TIF1 alpha Partial Recombinant Protein (H00008805-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIF1 alpha Partial Recombinant Protein (H00008805-Q01)

Discover more about diseases related to TIF1 alpha Partial Recombinant Protein (H00008805-Q01).
 

Pathways for TIF1 alpha Partial Recombinant Protein (H00008805-Q01)

View related products by pathway.

PTMs for TIF1 alpha Partial Recombinant Protein (H00008805-Q01)

Learn more about PTMs related to TIF1 alpha Partial Recombinant Protein (H00008805-Q01).
 

Research Areas for TIF1 alpha Partial Recombinant Protein (H00008805-Q01)

Find related products by research area.

Blogs on TIF1 alpha

There are no specific blogs for TIF1 alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TIF1 alpha Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM24