Thrombomodulin/BDCA-3 Antibody

Images

 
Western Blot: Thrombomodulin/BDCA-3 Antibody [NBP1-88133] - Analysis in human lung tissue.
Immunocytochemistry/ Immunofluorescence: Thrombomodulin/BDCA-3 Antibody [NBP1-88133] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Thrombomodulin/BDCA-3 Antibody [NBP1-88133] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Thrombomodulin/BDCA-3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DVISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYSRWARLDLNGAPLCGPLCVAVSAAEATVPSEPIWEEQQCEVKADGFLCEFHFPATCRPLAVEPGAAAAAVSITYG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
THBD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Thrombomodulin/BDCA-3 Protein (NBP1-88133PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Thrombomodulin/BDCA-3 Antibody

  • BDCA3
  • BDCA-3
  • CD141 antigen
  • CD141
  • Fetomodulin
  • THBD
  • THRM
  • Thrombomodulin
  • TM

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-07799
Species: Hu
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
AF1267
Species: Hu
Applications: WB, IP, Neut
AF2749
Species: Mu
Applications: WB, Flow, IP, CyTOF-ready, ICC
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
AF4885
Species: Mu
Applications: WB, IP
AF6036
Species: Hu
Applications: WB, IHC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-88133
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Thrombomodulin/BDCA-3 Antibody (NBP1-88133) (0)

There are no publications for Thrombomodulin/BDCA-3 Antibody (NBP1-88133).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Thrombomodulin/BDCA-3 Antibody (NBP1-88133) (0)

There are no reviews for Thrombomodulin/BDCA-3 Antibody (NBP1-88133). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Thrombomodulin/BDCA-3 Antibody (NBP1-88133) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Thrombomodulin/BDCA-3 Products

Bioinformatics Tool for Thrombomodulin/BDCA-3 Antibody (NBP1-88133)

Discover related pathways, diseases and genes to Thrombomodulin/BDCA-3 Antibody (NBP1-88133). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Thrombomodulin/BDCA-3 Antibody (NBP1-88133)

Discover more about diseases related to Thrombomodulin/BDCA-3 Antibody (NBP1-88133).
 

Pathways for Thrombomodulin/BDCA-3 Antibody (NBP1-88133)

View related products by pathway.

PTMs for Thrombomodulin/BDCA-3 Antibody (NBP1-88133)

Learn more about PTMs related to Thrombomodulin/BDCA-3 Antibody (NBP1-88133).

Blogs on Thrombomodulin/BDCA-3.

Thrombomodulin - A multifunctional protein with roles in inflammation and coagulation
Thrombomodulin, also known as BDCA-3, is a glycosylated transmembrane protein present on the surface of vascular endothelial cells. Thrombomodulin is a high-affinity receptor for thrombin, a key protein in the coagulation cascade. Formation of the...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Thrombomodulin/BDCA-3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol THBD
Entrez