THAP11 Antibody - BSA Free

Immunohistochemistry-Paraffin: THAP11 Antibody [NBP1-92494] - Staining of human lymph node shows strong nuclear positivity in non-germinal center cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

THAP11 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit THAP11 Antibody - BSA Free (NBP1-92494) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QLVVVGEEGFPDTGSDHSYSLSSGTTEEELLRKLNEQRDILALMEVKMKEMKGSIRHLRLTEAKLREELREKDRL
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: THAP11
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  THAP11 Protein (NBP1-92494PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for THAP11 Antibody - BSA Free

• CTG-B43a
• CTG-B45d
• HRIHFB2206
• Ronin
• THAP domain containing 11
• THAP domain-containing protein 11
• THAP11

Background

THAP11 is a member of the thanatos-associated proteins (THAP) family, which are zinc-dependent, sequence-specific DNA-binding factors involved in cell proliferation, apoptosis, cell cycle, chromatin modification, and transcriptional regulation (Zhu, et al). THAP11 has been hypothesized to be a cell growth inhibitor via the repression of c-myc (Zhu, et al), and THAP11 expression has also been linked to the proliferation of embryonic stem cells (Dejosez M et al).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: THAP11