Teashirt homolog 1 Antibody

Images

 
Western Blot: Teashirt homolog 1 Antibody [NBP1-87377] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-574
Immunocytochemistry/ Immunofluorescence: Teashirt homolog 1 Antibody [NBP1-87377] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Teashirt homolog 1 Antibody [NBP1-87377] - Staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Teashirt homolog 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YGSPFSESSDQLAHFKGSSSREEKEDPQCPDSVSYPQDSLAQIKAVYANLFSESCWSSLALDLKKSGSTTSTNDASQKESSAPTPTPPTCPVSTTGPTTSTPSTSCSSSTSHSSTTSTSSSSGYDWHQAALAKTLQQTSSYGLLPEPS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TSHZ1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Teashirt homolog 1 Protein (NBP1-87377PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Teashirt homolog 1 Antibody

  • Antigen NY-CO-33
  • NY-CO-33
  • SDCCAG33
  • Serologically defined colon cancer antigen 33teashirt family zinc finger 1
  • teashirt homolog 1
  • teashirt zinc finger homeobox 1
  • TSH1teashirt zinc finger 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NB200-527
Species: Hu, Mu
Applications: WB
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NBP1-88169
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, ISH
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-69295
Species: Hu
Applications: WB, ICC/IF, IHC
NB100-94887
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-314
Species: Hu
Applications: WB, IP, PLA
NB100-56681
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC-P
NB600-919
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P

Publications for Teashirt homolog 1 Antibody (NBP1-87377) (0)

There are no publications for Teashirt homolog 1 Antibody (NBP1-87377).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Teashirt homolog 1 Antibody (NBP1-87377) (0)

There are no reviews for Teashirt homolog 1 Antibody (NBP1-87377). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Teashirt homolog 1 Antibody (NBP1-87377) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Teashirt homolog 1 Products

Bioinformatics Tool for Teashirt homolog 1 Antibody (NBP1-87377)

Discover related pathways, diseases and genes to Teashirt homolog 1 Antibody (NBP1-87377). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Teashirt homolog 1 Antibody (NBP1-87377)

Discover more about diseases related to Teashirt homolog 1 Antibody (NBP1-87377).
 

Pathways for Teashirt homolog 1 Antibody (NBP1-87377)

View related products by pathway.

PTMs for Teashirt homolog 1 Antibody (NBP1-87377)

Learn more about PTMs related to Teashirt homolog 1 Antibody (NBP1-87377).

Blogs on Teashirt homolog 1

There are no specific blogs for Teashirt homolog 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Teashirt homolog 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TSHZ1