TFPI Antibody

Images

 
Western Blot: TFPI Antibody [NBP1-84831] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: TFPI Antibody [NBP1-84831] - Staining of human smooth muscle shows distinct positivity in endothelial.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TFPI Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TFPI
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TFPI Protein (NBP1-84831PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TFPI Antibody

  • convertin
  • EPI
  • EPITFPI1LACITFI
  • Extrinsic pathway inhibitor
  • LACI
  • Lipoprotein-associated coagulation inhibitor
  • TFPI
  • tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor)
  • tissue factor pathway inhibitor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-07799
Species: Hu
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
AF1267
Species: Hu
Applications: WB, IP, Neut
NBP2-42213
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
46420002
Species: Hu
Applications: WB, ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB2545
Species: Hu
Applications: WB, IHC, IP
NBP1-84831
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TFPI Antibody (NBP1-84831) (0)

There are no publications for TFPI Antibody (NBP1-84831).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TFPI Antibody (NBP1-84831) (0)

There are no reviews for TFPI Antibody (NBP1-84831). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TFPI Antibody (NBP1-84831) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TFPI Products

Bioinformatics Tool for TFPI Antibody (NBP1-84831)

Discover related pathways, diseases and genes to TFPI Antibody (NBP1-84831). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TFPI Antibody (NBP1-84831)

Discover more about diseases related to TFPI Antibody (NBP1-84831).
 

Pathways for TFPI Antibody (NBP1-84831)

View related products by pathway.

PTMs for TFPI Antibody (NBP1-84831)

Learn more about PTMs related to TFPI Antibody (NBP1-84831).

Blogs on TFPI

There are no specific blogs for TFPI, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TFPI Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TFPI
Entrez