TET1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TET1 Antibody [NBP1-88972] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear membrane.
Immunohistochemistry: TET1 Antibody [NBP1-88972] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TET1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VPPNPIATFNAPSKWPEPQSTVSYGLAVQGAIQILPLGSGHTPQSSSNSEKNSLPPVMAISNVENEKQVHISFLPANTQGFPLAPERGLFHASLGIAQLSQAGPSKSDRGSSQVSVTSTVHVVNTTVVTMPVPMVSTSSSSYTT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TET1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TET1 Protein (NBP1-88972PEP)
Publications
Read Publication using
NBP1-88972 in the following applications:

  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26622665).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TET1 Antibody

  • bA119F7.1
  • CXXC finger 6
  • CXXC6
  • CXXC6FLJ10839
  • FLJ41442
  • KIAA1676CXXC-type zinc finger protein 6
  • LCX
  • LCXEC 1.14.11.n2
  • Leukemia-associated protein with a CXXC domain
  • methylcytosine dioxygenase TET1
  • Ten-eleven translocation 1 gene protein
  • ten-eleven translocation-1
  • tet oncogene 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86126
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32104
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-01833
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NBP2-20602
Species: Hu, Mu, Bv, Xp
Applications: WB, ICC/IF, IHC, IHC-P, IP, IHC-WhMt
NBP1-86856
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB600-248
Species: Hu
Applications: WB, IP
AF1396
Species: Hu
Applications: WB
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF

Publications for TET1 Antibody (NBP1-88972)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for TET1 Antibody (NBP1-88972) (0)

There are no reviews for TET1 Antibody (NBP1-88972). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TET1 Antibody (NBP1-88972) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TET1 Products

Bioinformatics Tool for TET1 Antibody (NBP1-88972)

Discover related pathways, diseases and genes to TET1 Antibody (NBP1-88972). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TET1 Antibody (NBP1-88972)

Discover more about diseases related to TET1 Antibody (NBP1-88972).
 

Pathways for TET1 Antibody (NBP1-88972)

View related products by pathway.

PTMs for TET1 Antibody (NBP1-88972)

Learn more about PTMs related to TET1 Antibody (NBP1-88972).

Blogs on TET1

There are no specific blogs for TET1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TET1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TET1
Entrez
Uniprot