WIRE Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86856] - Analysis in human cerebral cortex and liver tissues using NBP1-86856 antibody. Corresponding WIRE RNA-seq data are presented for ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86856] - Staining of human cerebral cortex, colon, fallopian tube and liver using Anti-WIRE antibody NBP1-86856 (A) shows similar protein ...read more
Western Blot: WIRE Antibody [NBP1-86856] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86856] - Staining of human liver shows very weak positivyt in hepatocytes as expected.
Independent Antibodies: Western Blot: WIRE Antibody [NBP1-86856] - Analysis using Anti-WIPF2 antibody NBP1-86856 (A) shows similar pattern to independent antibody NBP1-86858 (B).
Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86856] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86856] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: WIRE Antibody [NBP1-86856] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WIRE Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PPPYRMHGSEPPSRGKPPPPPSRTPAGPPPPPPPPLRNGHRDSITTVRSFLDDFESKYSFHPVEDFPAPEEYKHFQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WIPF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
ICC/IF reported in scientific literature (PMID: 24413434). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
WIRE Protein (NBP1-86856PEP)
Publications
Read Publications using
NBP1-86856 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24413434)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WIRE Antibody

  • PP10631
  • WAS/WASL interacting protein family, member 2
  • WIP-related protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for WIRE Antibody (NBP1-86856)(3)

Reviews for WIRE Antibody (NBP1-86856) (0)

There are no reviews for WIRE Antibody (NBP1-86856). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for WIRE Antibody (NBP1-86856) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WIRE Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WIPF2