Teneurin-1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Teneurin-1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Teneurin-1
  
  

  Source: E.coli

  Amino Acid Sequence: DGRKPRQSYNSRETLHEYNQELRMNYNSQSRKRKEVEKSTQEMEFCETSHTLCSGYQTDMHSVSRHGYQLEMGSDVD

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: TENM1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25178It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Teneurin-1 Recombinant Protein Antigen

• odz, odd Oz/ten-m homolog 1(Drosophila)
• ODZ1
• ODZ3
• Protein Odd Oz/ten-m homolog 1
• Ten-1
• tenascin M
• tenascin M1
• Tenascin-M1
• teneurin 1
• Teneurin1
• Teneurin-1
• TEN-M1
• TNM
• TNM1

Background

Teneurin-1, also known as Teneurin Transmembrane Protein 1 or Ten-1, contains a 305 kDa and a 306 kDa isoform, and is involved in regulating the connections within the nervous system and neural development. Teneurin-1 is not currently being used in any disease research. The protein has not been found to interact with any other proteins, but is linked to transcription, stress and immune responses, and signal transduction.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TENM1