Recombinant Human Teneurin-1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Teneurin-1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 2616-2725 of Human ODZ1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TRRFADIQLQHGALCFNIRYGTTVEEEKNHVLEIARQRAVAQAWTKEQRRLQEGEEGIRAWTEGEKQQLLSTGRVQGYDGYFVLSVEQYLELSDSANNIHFMRQSEIGRR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TENM1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publications using H00010178-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Teneurin-1 Protein

  • odz, odd Oz/ten-m homolog 1(Drosophila)
  • ODZ1
  • ODZ3
  • Protein Odd Oz/ten-m homolog 1
  • Ten-1
  • tenascin M
  • tenascin M1
  • Tenascin-M1
  • teneurin 1
  • Teneurin1
  • Teneurin-1
  • TEN-M1
  • TNM
  • TNM1

Background

ODZ1 - odz, odd Oz/ten-m homolog 1(Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
AF972
Species: Hu
Applications: WB, Simple Western, IHC
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
MAB4077
Species: Hu
Applications: WB, IHC
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NBP1-33050
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Teneurin-1 Partial Recombinant Protein (H00010178-Q01)(2)

Reviews for Teneurin-1 Partial Recombinant Protein (H00010178-Q01) (0)

There are no reviews for Teneurin-1 Partial Recombinant Protein (H00010178-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Teneurin-1 Partial Recombinant Protein (H00010178-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Teneurin-1 Products

Bioinformatics Tool for Teneurin-1 Partial Recombinant Protein (H00010178-Q01)

Discover related pathways, diseases and genes to Teneurin-1 Partial Recombinant Protein (H00010178-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for Teneurin-1 Partial Recombinant Protein (H00010178-Q01)

Find related products by research area.

Blogs on Teneurin-1

There are no specific blogs for Teneurin-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Teneurin-1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TENM1
Entrez