Recombinant Human Teneurin-1 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, AP

Recombinant Human Teneurin-1 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acids 2616-2725 of Human ODZ1 partial ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: TRRFADIQLQHGALCFNIRYGTTVEEEKNHVLEIARQRAVAQAWTKEQRRLQEGEEGIRAWTEGEKQQLLSTGRVQGYDGYFVLSVEQYLELSDSANNIHFMRQSEIGRR

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: TENM1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Teneurin-1 GST (N-Term) Protein

• odz, odd Oz/ten-m homolog 1(Drosophila)
• ODZ1
• ODZ3
• Protein Odd Oz/ten-m homolog 1
• Ten-1
• tenascin M
• tenascin M1
• Tenascin-M1
• teneurin 1
• Teneurin1
• Teneurin-1
• TEN-M1
• TNM
• TNM1

Background

ODZ1 - odz, odd Oz/ten-m homolog 1(Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Publications for Teneurin-1 Partial Recombinant Protein (H00010178-Q01)(2)

Publications using H00010178-Q01

• Chand D, Colacci M, Dixon K et al. C-terminal region of teneurin-1 co-localizes with the dystroglycan complex in adult mouse testes and regulates testicular size and testosterone production. Histochem Cell Biol. 2013-10-24 [PMID: 24154551]
• Chand D, Casatti CA, de Lannoy L et al. C-terminal processing of the teneurin proteins: Independent actions of a teneurin C-terminal associated peptide in hippocampal cells. Mol Cell Neurosci. 2012-09-28 [PMID: 23026563]

Bioinformatics

• Gene Symbol: TENM1