Teneurin-1 Antibody (3G8)

Images

 
ELISA: Teneurin-1 Antibody (3G8) [H00010178-M01] - Detection limit for recombinant GST tagged ODZ1 is approximately 1ng/ml as a capture antibody.
Sandwich ELISA: Teneurin-1 Antibody (3G8) [H00010178-M01] - Detection limit for recombinant GST tagged ODZ1 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
3G8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Teneurin-1 Antibody (3G8) Summary

Immunogen
ODZ1 (NP_055068, 2616 a.a. ~ 2725 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TRRFADIQLQHGALCFNIRYGTTVEEEKNHVLEIARQRAVAQAWTKEQRRLQEGEEGIRAWTEGEKQQLLSTGRVQGYDGYFVLSVEQYLELSDSANNIHFMRQSEIGRR
Localization
Membrane; Single-pass type II membrane protein.
Specificity
ODZ1 - odz, odd Oz/ten-m homolog 1(Drosophila)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TENM1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Publications
Read Publications using H00010178-M01.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Teneurin-1 Antibody (3G8)

  • odz, odd Oz/ten-m homolog 1(Drosophila)
  • ODZ1
  • ODZ3
  • Protein Odd Oz/ten-m homolog 1
  • Ten-1
  • tenascin M
  • tenascin M1
  • Tenascin-M1
  • teneurin 1
  • Teneurin1
  • Teneurin-1
  • TEN-M1
  • TNM
  • TNM1

Background

ODZ1 (odz, odd Oz/ten-m homolog 1) is expressed in fetal brain and may have a role in cellular signal transduction.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
DVE00
Species: Hu
Applications: ELISA
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
1129-ER
Species: Hu
Applications: BA
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB100-64848
Species: Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB110-68136
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
DKK300
Species: Hu
Applications: ELISA
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP3-05061
Species: Hu, Mu
Applications: ICC/IF, WB
DVEC00
Species: Hu
Applications: ELISA
MAB4077
Species: Hu
Applications: IHC, WB
MAB1368
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
NBP1-33050
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00010178-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA

Publications for Teneurin-1 Antibody (H00010178-M01)(2)

Reviews for Teneurin-1 Antibody (H00010178-M01) (0)

There are no reviews for Teneurin-1 Antibody (H00010178-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Teneurin-1 Antibody (H00010178-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Teneurin-1 Products

Bioinformatics Tool for Teneurin-1 Antibody (H00010178-M01)

Discover related pathways, diseases and genes to Teneurin-1 Antibody (H00010178-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for Teneurin-1 Antibody (H00010178-M01)

Find related products by research area.

Blogs on Teneurin-1

There are no specific blogs for Teneurin-1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Teneurin-1 Antibody (3G8) and receive a gift card or discount.

Bioinformatics

Gene Symbol TENM1
Entrez
Uniprot