TEM Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TEM Antibody [NBP1-89939] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: TEM Antibody [NBP1-89939] - Staining of human cerebellum shows strong nuclear positivity in purkinje cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TEM Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVICRV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNMD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TEM Recombinant Protein Antigen (NBP1-89939PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TEM Antibody

  • BRICD4
  • BRICHOS domain containing 4
  • CHM1L
  • chondromodulin-I-like protein
  • hChM1L
  • hTeM
  • myodulin
  • TEM
  • tendin
  • tenomodulin
  • UNQ771/PRO1565

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB41681
Species: Hu
Applications: WB
NBP2-54703
Species: Hu
Applications: IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
AF853
Species: Mu
Applications: WB, IHC
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
779-G7/CF
Species: Mu
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
AF3075
Species: Hu
Applications: WB, ICC
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
NB600-844
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB600-408
Species: Hu, Mu, Rt, Po, Bv, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-77306
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-89939
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for TEM Antibody (NBP1-89939) (0)

There are no publications for TEM Antibody (NBP1-89939).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TEM Antibody (NBP1-89939) (0)

There are no reviews for TEM Antibody (NBP1-89939). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TEM Antibody (NBP1-89939) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TEM Products

TEM NBP1-89939

Bioinformatics Tool for TEM Antibody (NBP1-89939)

Discover related pathways, diseases and genes to TEM Antibody (NBP1-89939). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TEM Antibody (NBP1-89939)

Discover more about diseases related to TEM Antibody (NBP1-89939).
 

Pathways for TEM Antibody (NBP1-89939)

View related products by pathway.

PTMs for TEM Antibody (NBP1-89939)

Learn more about PTMs related to TEM Antibody (NBP1-89939).

Blogs on TEM

There are no specific blogs for TEM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TEM Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNMD