TEM Antibody - BSA Free

Western Blot: TEM Antibody [NBP1-70722] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml

Western Blot: TEM Antibody [NBP1-70722] - 721_B cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TEM Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to TNMD(tenomodulin) The peptide sequence was selected from the middle region of TNMD. Peptide sequence QNEQWVVPQVKVEKTRHARQASEEELPINDYTENGIEFDPMLDERGYCCI. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TNMD
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TEM Antibody - BSA Free

• BRICD4
• BRICHOS domain containing 4
• CHM1L
• chondromodulin-I-like protein
• hChM1L
• hTeM
• myodulin
• TEM
• tendin
• tenomodulin
• UNQ771/PRO1565

Background

TNMD is a single-pass type II membrane proteinPotential. It belongs to the chondromodulin-1 family and contains 1 BRICHOS domain. TNMD may be an angiogenesis inhibitor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TNMD