TEM Antibody


Western Blot: TEM Antibody [NBP1-70722] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
Western Blot: TEM Antibody [NBP1-70722] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

TEM Antibody Summary

Synthetic peptides corresponding to TNMD(tenomodulin) The peptide sequence was selected from the middle region of TNMD. Peptide sequence QNEQWVVPQVKVEKTRHARQASEEELPINDYTENGIEFDPMLDERGYCCI.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TNMD and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TEM Antibody

  • BRICD4
  • BRICHOS domain containing 4
  • CHM1L
  • chondromodulin-I-like protein
  • hChM1L
  • hTeM
  • myodulin
  • TEM
  • tendin
  • tenomodulin
  • UNQ771/PRO1565


TNMD is a single-pass type II membrane proteinPotential. It belongs to the chondromodulin-1 family and contains 1 BRICHOS domain. TNMD may be an angiogenesis inhibitor.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, IF
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Fe, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Hu
Applications: WB

Publications for TEM Antibody (NBP1-70722) (0)

There are no publications for TEM Antibody (NBP1-70722).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TEM Antibody (NBP1-70722) (0)

There are no reviews for TEM Antibody (NBP1-70722). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TEM Antibody (NBP1-70722) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TEM Products

TEM NBP1-70722

Bioinformatics Tool for TEM Antibody (NBP1-70722)

Discover related pathways, diseases and genes to TEM Antibody (NBP1-70722). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TEM Antibody (NBP1-70722)

Discover more about diseases related to TEM Antibody (NBP1-70722).

Pathways for TEM Antibody (NBP1-70722)

View related products by pathway.

PTMs for TEM Antibody (NBP1-70722)

Learn more about PTMs related to TEM Antibody (NBP1-70722).

Blogs on TEM

There are no specific blogs for TEM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TEM Antibody and receive a gift card or discount.


Gene Symbol TNMD