Home » TEM » TEM Antibodies » TEM Antibody

TEM Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: TEM Antibody [NBP1-70722] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
Western Blot: TEM Antibody [NBP1-70722] - Sample Tissue: Human Fetal Liver Antibody Dilution: 1.0 ug/ml
Western Blot: TEM Antibody [NBP1-70722] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TEM Antibody Summary

Immunogen
Synthetic peptides corresponding to TNMD(tenomodulin) The peptide sequence was selected from the middle region of TNMD. Peptide sequence QNEQWVVPQVKVEKTRHARQASEEELPINDYTENGIEFDPMLDERGYCCI. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNMD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against TNMD and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TEM Antibody

  • BRICD4
  • BRICHOS domain containing 4
  • CHM1L
  • chondromodulin-I-like protein
  • hChM1L
  • hTeM
  • myodulin
  • TEM
  • tendin
  • tenomodulin
  • UNQ771/PRO1565

Background

TNMD is a single-pass type II membrane proteinPotential. It belongs to the chondromodulin-1 family and contains 1 BRICHOS domain. TNMD may be an angiogenesis inhibitor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...


Chondromodulin-1/LECT1 ...
MAB41681
Chondromodulin-1/LECT1 Antibody (394002)
(1 Publication)
Species: Hu
Applications: WB
SCX Antibody
(PCRP-SCXA-2D11)
NBP3-07598
Protein Array: SCX Antibody (PCRP-SCXA-2D11) [NBP3-07598] - Analysis of Protein Array containing more than 19,000 full-length human proteins using SCX Mouse Monoclonal Antibody (PCRP-SCX-2D11).
Flow Cytometry: SCX Antibody (PCRP-SCXA-2D11) [NBP3-07598] - Flow Cytometric Analysis of PFA-fixed HeLa cells. SCX Mouse Monoclonal Antibody (PCRP-SCX-2D11) followed by goat anti- Mouse IgG-CF488 (blue); unstained cells (red).
Immunocytochemistry/Immunofluorescence: SCX Antibody (PCRP-SCXA-2D11) [NBP3-07598] - Immunofluorescence Analysis of HeLa cells using SCX Mouse Monoclonal Antibody (PCRP-SCXA-2D11) followed by goat anti- Mouse IgG-CF488 (green). CF640A phalloidin (red).
Species: Hu
Applications: Flow, ICC/IF, PA
Decorin Antibody
[Unconjugated]
AF143
Western blot shows lysates of human uterus tissue and human heart tissue. PVDF membrane was probed with 0.1 µg/mL of Goat Anti-Human Decorin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF143) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Decorin at approximately 100 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of human uterus and human heart tissue, loaded at 0.2 mg/mL. A specific band was detected for Decorin at approximately 140-149 kDa (as indicated) using 5 µg/mL of Goat Anti-Human Decorin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF143) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.        
Decorin was detected in immersion fixed paraffin-embedded sections of human breast using Goat Anti-Human Decorin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF143) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to intralobular stromal tissue. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(18 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
GDF-5/BMP-14
[Unconjugated]
853-G5/CF
GDF-5/BMP-14 [Unconjugated]
(8 Publications)
Species: Mu
Applications: BA
Aggrecan
Neoepitope Antibody -
NB100-74350
Western Blot: Aggrecan Neoepitope Antibody [NB100-74350] - Analysis of ACAN in U2OS cell lysate.
Western Blot: Aggrecan Neoepitope Antibody [NB100-74350] - Analysis of ACAN in L929 whole cell extract using NB100-74350.
Immunocytochemistry/Immunofluorescence: Aggrecan Neoepitope Antibody [NB100-74350] - Detection of ACAN in OA cartilage using NB100-74350.
(23 Publications)
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
GDF-7/BMP-12
[Unconjugated]
8386-G7
Recombinant Human GDF-7 stimulates alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is 0.25-1.25 μg/mL.
(3 Publications)
Species: Hu
Applications: BA
Tenascin C
Antibody (4C8MS) - BS
NB110-68136
Flow Cytometry: Tenascin C Antibody (4C8MS) [NB110-68136] - An intracellular stain was performed on SK-MEL-28 cells with Tenascin C Antibody (4C8MS) NB110-68136 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) APC-conjugated secondary antibody (F0101B, R&D Systems).
Immunocytochemistry/Immunofluorescence: Tenascin C Antibody (4C8MS) [NB110-68136] - SK-MEL-28 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-Tenascin C at 5 ug/ml overnight at 4C and detected with an anti-Mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow Cytometry: Tenascin C Antibody (4C8MS) [NB110-68136] - An intracellular stain was performed on SK-MEL-28 cells with Tenascin C Antibody (4C8MS) NB110-68136AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
(2 Reviews)
(23 Publications)
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Osteocalcin
Antibody (190125)
MAB1419
Saos‑2 human osteosarcoma cell line was stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Human osteoblasts were stained with Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
Osteocalcin was detected in human mesenchymal stem cells differentiated into osteocytes using Mouse Anti-Human/Rat Osteocalcin Monoclonal Antibody (Catalog # MAB1419) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(4 Reviews)
(27 Publications)
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
SOX9 Antibody
[Unconjugated]
AF3075
SOX9 was detected in immersion fixed BG01V human embryonic stem cells differentiated into early proximal lung progenitor cells using Goat Anti-Human SOX9 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3075) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, KATO‑III human gastric carcinoma cell line, COLO 205 human colorectal adenocarcinoma cell line, and Hep3B human hepatocellular carcinoma cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human SOX9 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3075) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for SOX9 at approximately 75 kDa (as indicated). GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
SOX9 was detected in immersion fixed HEK293 human embryonic kidney cell line using 10 µg/mL Human SOX9 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3075) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(6 Reviews)
(54 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
Musculin Antibody
(1D1)
H00009242-M01
Western Blot: Musculin Antibody (1D1) [H00009242-M01] - Detection against Immunogen (35.2 KDa) .
(1 Review)
Species: Hu
Applications: ELISA, WB
GDF-8/Myostatin
[Unconjugated]
788-G8/CF
1 μg/lane of Recombinant Human/Mouse/Rat GDF-8/Myostatin was resolved withSDS-PAGE under reducing (R) andnon-reducing (NR) conditions and visualized by silver staining, showing the main bands at 12 kDa and 24 kDa, respectively.
Recombinant Human/Mouse/Rat GDF-8/Myostatin (Catalog # 788-G8/CF) induces hemoglobin expression in the K562 human chronic myelogenous leukemia cell line. The ED50 for this effect is 2-10 ng/mL.
(39 Publications)
Species: Hu, Mu, Rt
Applications: BA
VEGF [HRP]
DVE00
(26 Reviews)
(580 Publications)
Species: Hu
Applications: ELISA
Collagen II
Antibody (5B2.5) - BS
NB600-844
Immunohistochemistry-Paraffin: Collagen II Antibody (5B2.5) [NB600-844] - Analysis of a FFPE section of human cartilage using 1:200 dilution of Collagen II [5B2.5] antibody (NB600-844). The signal was developed using HRP-DAB method which followed counterstaining of the cells with hematoxylin.
Immunohistochemistry-Paraffin: Collagen II Antibody (5B2.5) [NB600-844] - Staining results for the process of differentiation induction in the RCCS environment. Collagen II immune-histochemical staining on cells after inoculation onto slides. Image collected and cropped by Citeab from the following publication (Chondrogenic differentiation of bone marrow-derived mesenchymal stem cells following transfection with Indian hedgehog and sonic hedgehog using a rotary cell culture system. Cell Mol Biol Lett (2019)) licensed under a CC-BY licence.
Western Blot: Collagen II Antibody (5B2.5) [NB600-844] - Expression levels of related genes during differentiation induction in the 2D environment. Expression of ACAN, collagen II, collagen X and Runx2 was detected by western blotting on day 10 during induction. Image collected and cropped by Citeab from the following publication (Chondrogenic differentiation of bone marrow-derived mesenchymal stem cells following transfection with Indian hedgehog and sonic hedgehog using a rotary cell culture system. Cell Mol Biol Lett (2019)) licensed under a CC-BY licence.
(31 Publications)
Species: Ch, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

5'-Nucleotidase/CD73 A ...
NBP2-48480
Flow (Cell Surface): 5'-Nucleotidase/CD73 Antibody (AD2) [NBP2-48480] - A surface stain was performed on U87 MG cells with 5'-Nucleotidase/CD73 Antibody (AD2) antibody NBP2-48480 (blue) and a matched isotype control (orange). Cells were incubated in an antibody dilution of 1 ug/mL for 20 minutes at room temperature, followed by Dylight488-conjugated anti-mouse secondary antibody.
Flow (Cell Surface): 5'-Nucleotidase/CD73 Antibody (AD2) [NBP2-48480] - A cell surface stain was performed on U87MG cells with NBP2-48480APC (blue) and a matched isotype control NBP2-27287APC (orange). Cells were incubated in an antibody dilution of 0.5 ug/mL for 20 minutes at room temperature. Both antibodies were conjugated to Allophycocyanin. Image using the Allophycocyanin form of this antibody.
Flow Cytometry: 5'-Nucleotidase/CD73 Antibody (AD2) [NBP2-48480] - A surface stain was performed on CD3+ human peripheral blood lymphocytes with CD73 (AD2) antibody NBP2-48480AF488 and a matched isotype control NBP2-27287AF488. Cells were incubated in an antibody dilution of 10 ug/mL for 20 minutes at room temperature. A co-stain was performed with NBP2-25186PCP.
(1 Review)
(15 Publications)
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
Collagen I Antibody
NB600-408
Immunohistochemistry-Paraffin: Collagen I Antibody [NB600-408] - Balb/3T3 mouse embryonic fibroblast cell line stained with Collagen I antibody. IHC-P image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Collagen I Antibody [NB600-408] - Mouse pancreas tissue stained with Collagen I antibody. IHC-P image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Collagen I Antibody [NB600-408] - Human lung tissue section stained with Collagen I antibody at 1:400.
(16 Reviews)
(227 Publications)
Species: Bv, Hu, Mu, Po, Rb, Rt
Applications: ELISA, Flow, FLISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr, PAGE, WB
SnoN Antibody
NBP1-77306
Immunofluorescence: SnoN Antibody [NBP1-77306] - HeLa cells stained with SnoN antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: SnoN Antibody [NBP1-77306] - Mouse lung tissue with SnoN antibody at 5 ug/ml.
Western Blot: SnoN Antibody [NBP1-77306] - Analysis of SnoN in A431 cell lysate with SnoN antibody at (A) 0.5 and (B) 1 ug/mL.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB

Publications for TEM Antibody (NBP1-70722) (0)

There are no publications for TEM Antibody (NBP1-70722).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TEM Antibody (NBP1-70722) (0)

There are no reviews for TEM Antibody (NBP1-70722). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TEM Antibody (NBP1-70722) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TEM Products

Array NBP1-70722

Bioinformatics Tool for TEM Antibody (NBP1-70722)

Discover related pathways, diseases and genes to TEM Antibody (NBP1-70722). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TEM Antibody (NBP1-70722)

Discover more about diseases related to TEM Antibody (NBP1-70722).
 

Pathways for TEM Antibody (NBP1-70722)

View related products by pathway.

PTMs for TEM Antibody (NBP1-70722)

Learn more about PTMs related to TEM Antibody (NBP1-70722).

Blogs on TEM

There are no specific blogs for TEM, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TEM Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol TNMD