Tec Antibody (1C11)

Images

 
There are currently no images for Tec Antibody (H00007006-M01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
1C11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Tec Antibody (1C11) Summary

Immunogen
TEC (NP_003206 311 a.a. - 410 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSVKGKNAPTTAGFSYEKWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDF
Localization
Cytoplasmic
Specificity
TEC - tec protein tyrosine kinase
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TEC
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Tec Antibody (1C11)

  • EC 2.7.10
  • EC 2.7.10.2
  • MGC126760
  • MGC126762
  • PSCTK4
  • PSCTK4tyrosine-protein kinase Tec
  • tec protein tyrosine kinase
  • Tec

Background

The protein encoded by this gene belongs to the Tec family of non-receptor protein-tyrosine kinases containing a pleckstrin homology domain. Tec family kinases are involved in the intracellular signaling mechanisms of cytokine receptors, lymphocyte surface antigens, heterotrimeric G-protein coupled receptors, and integrin molecules. They are also key players in the regulation of the immune functions. Tec kinase is an integral component of T cell signaling and has a distinct role in T cell activation. This gene may be associated with myelodysplastic syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
796-IC
Species: Mu
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-78295
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for Tec Antibody (H00007006-M01) (0)

There are no publications for Tec Antibody (H00007006-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tec Antibody (H00007006-M01) (0)

There are no reviews for Tec Antibody (H00007006-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Tec Antibody (H00007006-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Tec Products

Bioinformatics Tool for Tec Antibody (H00007006-M01)

Discover related pathways, diseases and genes to Tec Antibody (H00007006-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tec Antibody (H00007006-M01)

Discover more about diseases related to Tec Antibody (H00007006-M01).
 

Pathways for Tec Antibody (H00007006-M01)

View related products by pathway.

PTMs for Tec Antibody (H00007006-M01)

Learn more about PTMs related to Tec Antibody (H00007006-M01).
 

Research Areas for Tec Antibody (H00007006-M01)

Find related products by research area.

Blogs on Tec

There are no specific blogs for Tec, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tec Antibody (1C11) and receive a gift card or discount.

Bioinformatics

Gene Symbol TEC
Entrez
OMIM
Uniprot