TCHP Antibody


Western Blot: TCHP Antibody [NBP1-89572] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: TCHP Antibody [NBP1-89572] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, cytosol & centrosome.
Immunohistochemistry-Paraffin: TCHP Antibody [NBP1-89572] - Staining of human liver shows distinct membranous positivity in hepatocytes.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

TCHP Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MEAFRQKAELGRFLRHQYNAQLSRRTQQIQEELEADRRILQALLEKEDESQRLHLARREQVMADVAWMKQAIEEQ
Specificity of human TCHP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TCHP Protein (NBP1-89572PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TCHP Antibody

  • TpMs
  • trichoplein, keratin filament binding


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Rb, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Ce
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for TCHP Antibody (NBP1-89572) (0)

There are no publications for TCHP Antibody (NBP1-89572).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCHP Antibody (NBP1-89572) (0)

There are no reviews for TCHP Antibody (NBP1-89572). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TCHP Antibody (NBP1-89572) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TCHP Products

Bioinformatics Tool for TCHP Antibody (NBP1-89572)

Discover related pathways, diseases and genes to TCHP Antibody (NBP1-89572). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCHP Antibody (NBP1-89572)

Discover more about diseases related to TCHP Antibody (NBP1-89572).

Pathways for TCHP Antibody (NBP1-89572)

View related products by pathway.

PTMs for TCHP Antibody (NBP1-89572)

Learn more about PTMs related to TCHP Antibody (NBP1-89572).

Blogs on TCHP

There are no specific blogs for TCHP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TCHP Antibody and receive a gift card or discount.


Gene Symbol TCHP