Trichohyalin Antibody - BSA Free

Immunohistochemistry-Paraffin: Trichohyalin Antibody [NBP1-80687] - Staining of human placenta shows strong cytoplasmic and nuclear positivity in trophoblastic cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Trichohyalin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Trichohyalin Antibody - BSA Free (NBP1-80687) is a polyclonal antibody validated for use in IHC and WB. Anti-Trichohyalin Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QEKSRREEQELWQEEEQKRRQERERKLREEHIRRQQKEEQRHRQVGEIKSQEGKGHGRLLEPGTHQFASVPVRSSPLYEY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TCHH
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Trichohyalin Protein (NBP1-80687PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Trichohyalin Antibody - BSA Free

• THL
• TRHY
• trichohyalin

Background

Trichohyalin is an intermediate filament-associated protein that associates in regular arrays with keratin intermediate filaments (KIF) of the inner root sheath cells of the hair follicle and the granular layer of the epidermis. It later becomes cross-linked to KIF by isodipeptide bonds. It may serve as scaffold protein, together with involucrin, in the organization of the cell envelope or even anchor the cell envelope to the KIF network. It may be involved in its own calcium-dependent postsynthetic processing during terminal differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Trichohyalin Antibody (NBP1-80687)(2)

Publications using NBP1-80687

• Katz LS, Argmann C, Lambertini L et al. T3 and Glucose Increase Expression of Phosphoenolpyruvate Carboxykinase (PCK1) Leading to Increased beta -Cell Proliferation Molecular metabolism 2022-11-28 [PMID: 36455788] (Chemotaxis, Rat)
• Liu W, Lu X, Zhao ZH et al. SRSF10 is essential for progenitor spermatogonia expansion by regulating alternative splicing eLife 2022-11-10 [PMID: 36355419] (WB, Mouse)

Bioinformatics

• Gene Symbol: TCHH
• Entrez:
  • 7062(Human)
• Uniprot:
  • Q07283(Human)