Ninein Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Ninein Antibody [NBP2-13657] - Staining of human cell line U-251 MG shows localization to nucleoli and centrosome.
Immunohistochemistry-Paraffin: Ninein Antibody [NBP2-13657] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: Ninein Antibody [NBP2-13657] - Staining of human tonsil shows moderate cytoplasmic and membranous positivity in germinal center cells.
Immunohistochemistry-Paraffin: Ninein Antibody [NBP2-13657] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Ninein Antibody [NBP2-13657] - Staining of human stomach shows moderate cytoplasmic positivity in parietal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ninein Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EERLTQMRNEYERQCRVLQDQVDELQSELEEYRAQGRVLRLPLKNSPSEE VEANSGGIEPEHGLGSEECNPLNMSIEAELVIEQMKEQHHRDICCLRLEL EDKVRHYEKQLDETVVSCKKAQENMKQRHENETHTL
Marker
Centrosome Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NIN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Ninein Protein (NBP2-13657PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-13657 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Ninein Antibody

  • Glycogen synthase kinase 3 beta-interacting protein
  • GSK3B-interacting protein
  • hNinein
  • KIAA1565
  • ninein (GSK3B interacting protein)
  • ninein centrosomal protein
  • ninein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88795
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-87772
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-87195
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00011190-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H00027349-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP2-80461
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-81451
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47470
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-14909
Species: Bv, Hu
Applications: ICC/IF, IHC-P, IP, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
DLP00
Species: Hu
Applications: ELISA
NBP2-13657
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Ninein Antibody (NBP2-13657) (0)

There are no publications for Ninein Antibody (NBP2-13657).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Ninein Antibody (NBP2-13657) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP2-13657:
Filter by Applications
Immunocytochemistry
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry Ninein NBP2-13657
Enlarge
5
reviewed by:
Verified Customer
Immunocytochemistry Human 10/21/2021
View

Summary

ApplicationImmunocytochemistry
Sample Testedbrain microvascular endothelial cells
SpeciesHuman
Lot000016854

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Ninein Antibody (NBP2-13657) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ninein Products

Bioinformatics Tool for Ninein Antibody (NBP2-13657)

Discover related pathways, diseases and genes to Ninein Antibody (NBP2-13657). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ninein Antibody (NBP2-13657)

Discover more about diseases related to Ninein Antibody (NBP2-13657).
 

Pathways for Ninein Antibody (NBP2-13657)

View related products by pathway.

PTMs for Ninein Antibody (NBP2-13657)

Learn more about PTMs related to Ninein Antibody (NBP2-13657).
 

Research Areas for Ninein Antibody (NBP2-13657)

Find related products by research area.

Blogs on Ninein

There are no specific blogs for Ninein, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Verified Customer
10/21/2021
Application: Immunocytochemistry
Species: Human

Bioinformatics

Gene Symbol NIN