Ninein Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Ninein Antibody [NBP2-13657] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli & centrosome.
Immunohistochemistry-Paraffin: Ninein Antibody [NBP2-13657] - Staining of human appendix shows distinct dot-like positivity in lymphoid cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ninein Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EERLTQMRNEYERQCRVLQDQVDELQSELEEYRAQGRVLRLPLKNSPSEE VEANSGGIEPEHGLGSEECNPLNMSIEAELVIEQMKEQHHRDICCLRLEL EDKVRHYEKQLDETVVSCKKAQENMKQRHENETHTL
Marker
Centrosome Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NIN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Ninein Protein (NBP2-13657PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Ninein Antibody

  • Glycogen synthase kinase 3 beta-interacting protein
  • GSK3B-interacting protein
  • hNinein
  • KIAA1565
  • ninein (GSK3B interacting protein)
  • ninein centrosomal protein
  • ninein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-61071
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-87196
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF6567
Species: Hu, Mu
Applications: WB, IHC
NBP2-57371
Species: Hu
Applications: ICC/IF
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP1-84498
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81451
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-14909
Species: Hu
Applications: WB, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-13657
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Ninein Antibody (NBP2-13657) (0)

There are no publications for Ninein Antibody (NBP2-13657).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ninein Antibody (NBP2-13657) (0)

There are no reviews for Ninein Antibody (NBP2-13657). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Ninein Antibody (NBP2-13657) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ninein Products

Bioinformatics Tool for Ninein Antibody (NBP2-13657)

Discover related pathways, diseases and genes to Ninein Antibody (NBP2-13657). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ninein Antibody (NBP2-13657)

Discover more about diseases related to Ninein Antibody (NBP2-13657).
 

Pathways for Ninein Antibody (NBP2-13657)

View related products by pathway.

PTMs for Ninein Antibody (NBP2-13657)

Learn more about PTMs related to Ninein Antibody (NBP2-13657).

Blogs on Ninein

There are no specific blogs for Ninein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ninein Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NIN