Ninein Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Ninein Antibody [NBP2-13657] - Staining of human cell line U-251 MG shows localization to nucleoli and centrosome.

Immunohistochemistry-Paraffin: Ninein Antibody [NBP2-13657] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: Ninein Antibody [NBP2-13657] - Staining of human tonsil shows moderate cytoplasmic and membranous positivity in germinal center cells.

Immunohistochemistry-Paraffin: Ninein Antibody [NBP2-13657] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: Ninein Antibody [NBP2-13657] - Staining of human stomach shows moderate cytoplasmic positivity in parietal cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Ninein Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Ninein Antibody - BSA Free (NBP2-13657) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-Ninein Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: EERLTQMRNEYERQCRVLQDQVDELQSELEEYRAQGRVLRLPLKNSPSEEVEANSGGIEPEHGLGSEECNPLNMSIEAELVIEQMKEQHHRDICCLRLELEDKVRHYEKQLDETVVSCKKAQENMKQRHENETHTL
• Marker: Centrosome Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NIN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Ninein Protein (NBP2-13657PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Ninein Antibody - BSA Free

• Glycogen synthase kinase 3 beta-interacting protein
• GSK3B-interacting protein
• hNinein
• KIAA1565
• ninein (GSK3B interacting protein)
• ninein centrosomal protein
• ninein

Background

Ninein encodes one of the proteins important for centrosomal function. This protein is important for positioning and anchoring the microtubules minus-ends in epithelial cells. Localization of this protein to the centrosome requires three leucine zippers in the central coiled coil domain. Multiple alternatively spliced transcript variants that encode different isoforms have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Ninein Antibody (NBP2-13657)(1)

Publication using NBP2-13657

• Thirugnanam K, Gupta A, Nunez F et al. Brain microvascular endothelial cells possess a second cilium that arises from the daughter centriole Frontiers in molecular biosciences 2023-11-06 [PMID: 38028541] (ICC/IF, Mouse)

Review for Ninein Antibody (NBP2-13657) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: KARTHIKEYAN THIRUGNANAM ICC Human 10/21/2021

Summary

• Application: Immunocytochemistry
• Sample Tested: brain microvascular endothelial cells
• Species: Human
• Lot: 000016854

Bioinformatics

• Gene Symbol: NIN