ODF2 Antibody (1A1)

Images

 
Western Blot: ODF2 Antibody (1A1) [H00004957-M01] - Detection against Immunogen (36.63 KDa).
Immunocytochemistry/ Immunofluorescence: ODF2 Antibody (1A1) [H00004957-M01] - Co-staining of ODF2 (Cy3), DAPI and r-tubulin (Alexa Fluor 488) in RPE1 cell line. ODF2 stains the subdistal appendage of mother centriole. ...read more
Immunocytochemistry/ Immunofluorescence: ODF2 Antibody (1A1) [H00004957-M01] - Analysis of monoclonal antibody to ODF2 on HeLa cell. Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity Hu, CeSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clone
1A1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ODF2 Antibody (1A1) Summary

Immunogen
ODF2 (NP_002531.3 706 a.a. - 804 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP
Specificity
ODF2 - outer dense fiber of sperm tails 2 (1A1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ODF2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. ICC/IF usage reported in scientific literature. IHC usage reported in scientific literature (PMID: 24231678).
Reviewed Applications
Read 2 Reviews rated 5
using
H00004957-M01 in the following applications:

Publications
Read Publications using
H00004957-M01 in the following applications:

  • 5 publications
  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

C. elegans reactivity reported in scientific literature (PMID: 24231678).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ODF2 Antibody (1A1)

  • Cenexin
  • FLJ44866
  • MGC111096
  • MGC9034
  • ODF2/1
  • ODF2/2
  • ODF8484-kD
  • outer dense fiber of sperm tails 2
  • outer dense fiber protein 2
  • sperm tail structural protein

Background

The outer dense fibers are cytoskeletal structures that surround the axoneme in the middle piece and principal piece of the sperm tail. The fibers function in maintaining the elastic structure and recoil of the sperm tail as well as in protecting the tail from shear forces during epididymal transport and ejaculation. Defects in the outer dense fibers lead to abnormal sperm morphology and infertility. This gene encodes one of the major outer dense fiber proteins. Multiple protein isoforms are encoded by transcript variants of this gene; however, not all isoforms and variants have been fully described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38050
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IF
H00006676-Q01
Species: Hu
NB100-74638
Species: Hu
Applications: WB (-), ICC/IF, IP
NBP2-13657
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005347-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-88795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37602
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-43333
Species: Mu
Applications: WB
NBP1-90614
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2030
Species: Hu
Applications: WB, IHC
NBP1-87947
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14040
Species: Hu
Applications: WB, IHC, IHC-P
H00146852-P01
Species: Hu
NBP1-90363
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58906
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00004957-M01
Species: Hu, Ce
Applications: WB, ELISA, ICC/IF, IHC

Publications for ODF2 Antibody (H00004957-M01)(8)

We have publications tested in 2 confirmed species: Human, C. elegans.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(5)
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(4)
C. elegans
(1)
All Species
Showing Publications 1 - 8 of 8.
Publications using H00004957-M01 Applications Species
Hiraiwa T, Nakai Y, Yamada T et al. Quantitative analysis of sensitivity to a Wnt3a gradient in determination of the pole-to-pole axis of mitotic cells by using a microfluidic device. FEBS Open Bio Sep 16 2018 [PMID: 30524943] (ICC/IF, Human) ICC/IF Human
Xu Q, Zhang Y, Wei Q et al. Phosphatidylinositol phosphate kinase PIPKIgamma and phosphatase INPP5E coordinate initiation of ciliogenesis. Nat Commun 2016 Feb 26 [PMID: 26916822] (WB) WB
Alby C, Piquand K, Huber C et al. Mutations in KIAA0586 Cause Lethal Ciliopathies Ranging from a Hydrolethalus Phenotype to Short-Rib Polydactyly Syndrome. Am J Hum Genet 2015 Aug 6 [PMID: 26166481]
Failler M, Gee HY, Krug P et al. Mutations of CEP83 Cause Infantile Nephronophthisis and Intellectual Disability. Am. J. Hum. Genet. 2014 May 28 [PMID: 24882706] (ICC/IF, Human) ICC/IF Human
Xu Q, Zhang Y, Xiong X et al. Type Igamma phosphatidylinositol phosphate kinase targets to the centrosome and restrains centriole duplication. J Cell Sci. 2014 Jan 16 [PMID: 24434581]
Wei Q, Xu Q, Zhang Y et al. Transition fibre protein FBF1 is required for the ciliary entry of assembled intraflagellar transport complexes. Nat Commun. 2013 Nov 15 [PMID: 24231678] (IHC, ICC/IF, C. elegans) IHC, ICC/IF C. elegans
Tanos BE, Yang HJ, Soni R et al. Centriole distal appendages promote membrane docking, leading to cilia initiation. Genes Dev 2013 Jan 15 [PMID: 23348840] (ICC/IF, Human) ICC/IF Human
Izumi H, Kaneko Y. Evidence of asymmetric cell division and centrosome inheritance in human neuroblastoma cells Proc Natl Acad Sci 2012 Oct 11 [PMID: 23064640] (ICC/IF, Human) ICC/IF Human

Reviews for ODF2 Antibody (H00004957-M01) (2) 52

Average Rating: 5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Human.

Reviews using H00004957-M01:
Filter by Applications
IF
(1)
ICC
(1)
All Applications
Filter by Species
Human
(2)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence ODF2 H00004957-M01
Enlarge
reviewed by:
Anonymous
IF Human 04/09/2019
View

Summary

ApplicationImmunofluorescence
Sample TestedRPE1 cells,hTERT RPE-1 cell line from ATCC
SpeciesHuman
LotG9131-1A1

Comments

CommentsFix by cold MEOH for 10 mins. Block with 3% BSA for 0.5 hours at room temperature.
Dilute the ab at 1:100 in 3% BSA and incubate with cells for 2 hours at room temperature.
 
reviewed by:
ICC Human 08/25/2010
View

Summary

ApplicationImmunocytochemistry
Sample TestedhTERT RPE-1 cell line from ATCC
SpeciesHuman
CommentsThis ODF2 monoclonal antibody works very well in IF assay. It is a good mother centriole marker.

Blocking

Blocking DetailsBlocking Buffer: 3% BSA, Blocking Time: 1 hour, Blocking Temp: room temperature

Primary Anitbody

Dilution RatioPrimary Ab Dilution Ratio: 1:200, Primary Ab Incubation Time: 1 hour, Primary Ab Incubation Temp: 37 degrees Celsius

Secondary Antibody

Secondary DescriptionSecondary Ab: Alexa Fluor 555 goat anti-mouse IgG2a (?2a), Secondary Ab Dilution: 1:1000
Secondary Manufacturer Cat#Invitrogen A21137

Details

Fixation DetailsSample Preparation: 3d old in growth medium

Comments

CommentsThis ODF2 monoclonal antibody works very well in IF assay. It is a good mother centriole marker.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ODF2 Antibody (H00004957-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ODF2 Products

Bioinformatics Tool for ODF2 Antibody (H00004957-M01)

Discover related pathways, diseases and genes to ODF2 Antibody (H00004957-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ODF2 Antibody (H00004957-M01)

Discover more about diseases related to ODF2 Antibody (H00004957-M01).
 

Pathways for ODF2 Antibody (H00004957-M01)

View related products by pathway.

PTMs for ODF2 Antibody (H00004957-M01)

Learn more about PTMs related to ODF2 Antibody (H00004957-M01).

Blogs on ODF2

There are no specific blogs for ODF2, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
2
4
0
3
0
2
0
1
0

Anonymous
04/09/2019
Application: IF
Species: Human

 

08/25/2010
Application: ICC
Species: Human

Bioinformatics

Gene Symbol ODF2
Entrez
Uniprot