ODF2 Antibody (1A1) - Azide and BSA Free

Western Blot: ODF2 Antibody (1A1) [H00004957-M01] - Detection against Immunogen (36.63 KDa) .

Immunocytochemistry/Immunofluorescence: ODF2 Antibody (1A1) [H00004957-M01] - The localization and function of DYF-19 are highly conserved In IMCD3 cells, FBF1 localizes above rootlet and subdistal appendage protein ODF2 and completely colocalizes with distal appendage protein CEP164. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/ncomms3750) licensed under a CC-BY license.

Immunocytochemistry/Immunofluorescence: ODF2 Antibody (1A1) [H00004957-M01] - Co-staining of ODF2 (Cy3), DAPI and r-tubulin (Alexa Fluor 488) in RPE1 cell line. ODF2 stains the subdistal appendage of mother centriole. Cells were fixed with cold methanol, 10min. Blocked with 3% BSA for 30min at room temperature. ODF2 antibody was used at 1:100. Image from verified customer review.

Immunocytochemistry/Immunofluorescence: ODF2 Antibody (1A1) [H00004957-M01] - Analysis of monoclonal antibody to ODF2 on HeLa cell . Antibody concentration 10 ug/ml.

Immunocytochemistry/ Immunofluorescence: ODF2 Antibody (1A1) [H00004957-M01] - The localization & function of DYF-19 are highly conservedEither endogenous (a) or overexpressed (b) FBF1, the mammalian homolog of worm DYF-19, localizes specifically on one centriole with a ring-like pattern in IMCD3 cells. c, FBF1 localizes at the ciliary base, above the basal body. d, In IMCD3 cells, FBF1 localizes above rootlet & subdistal appendage protein ODF2 & completely colocalizes with distal appendage protein CEP164. e, Immuno-EM demonstrates that FBF1 localizes specifically to distal appendages of mother centrioles. f–h, Knock-down of FBF1 leads to severely truncated cilia in most RNAi-treated hTERT-RPE cells. Data are represented as mean of 3 independent experiments (n=200) & error bars indicate s.d. Significant differences were identified by the Student’s t-test. *P<0.001. i & j, The IFT-B component IFT88, but not the IFT-A component IFT140, enters the truncated cilia of FBF1-knockdown hTERT-RPE cells. Arrows indicate the tips of truncated cilia. k, Endogenous IFT54 immunoprecipitates with FBF1 in hTERT-RPE cells. l, HEK293 cells were transiently transfected with FLAG-HA-tagged FBF1, & 48 hours later, cells were subjected to immunoprecipitation using normal mouse IgG (mIgG) or anti-IFT54 antibody. 50 μg protein were loaded into each lane. Bars: c, 1μm; e, 200 nm; others, 20 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/24231678), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Ce
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 1A1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ODF2 Antibody (1A1) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: ODF2 (NP_002531.3, 706 a.a. ~ 804 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLKDRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYSTFLTSSPIRSRSPP
• Specificity: ODF2 - outer dense fiber of sperm tails 2 (1A1)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ODF2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:10-1:500
  • Immunohistochemistry 1:10-1:500
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. ICC/IF usage reported in scientific literature. IHC usage reported in scientific literature (PMID: 24231678).

Reactivity Notes

C. elegans reactivity reported in scientific literature (PMID: 24231678).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ODF2 Antibody (1A1) - Azide and BSA Free

• Cenexin
• FLJ44866
• MGC111096
• MGC9034
• ODF2/1
• ODF2/2
• ODF8484-kD
• outer dense fiber of sperm tails 2
• outer dense fiber protein 2
• sperm tail structural protein

Background

The outer dense fibers are cytoskeletal structures that surround the axoneme in the middle piece and principal piece of the sperm tail. The fibers function in maintaining the elastic structure and recoil of the sperm tail as well as in protecting the tail from shear forces during epididymal transport and ejaculation. Defects in the outer dense fibers lead to abnormal sperm morphology and infertility. This gene encodes one of the major outer dense fiber proteins. Multiple protein isoforms are encoded by transcript variants of this gene; however, not all isoforms and variants have been fully described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ODF2 Antibody (H00004957-M01)(14)

Publications using H00004957-M01

• Ching K, Wang JT, Stearns T Long-range migration of centrioles to the apical surface of the olfactory epithelium eLife 2022-04-14 [PMID: 35420544] (ICC/IF, Mouse)
• Yingyi Z, Jielu H, Mariana T et al. FBF1 deficiency promotes beiging and healthy expansion of white adipose tissue. Cell Rep. 2021-08-03 [PMID: 34348145]
• H Yan, C Chen, H Chen, H Hong, Y Huang, K Ling, J Hu, Q Wei TALPID3 and ANKRD26 selectively orchestrate FBF1 localization and cilia gating Nat Commun, 2020-05-04;11(1):2196. 2020-05-04 [PMID: 32366837]
• Kodani A, Kenny C, Lai A et al. Posterior Neocortex-Specific Regulation of Neuronal Migration by CEP85L Identifies Maternal Centriole-Dependent Activation of CDK5. Neuron. 2020-02-13 [PMID: 32097629]
• Eunji J, Tae-Ik C, Ji-Eun L et al. ESCRT subunit CHMP4B localizes to primary cilia and is required for the structural integrity of the ciliary membrane. FASEB J. 2019-11-29 [PMID: 31914703]
• Hiraiwa T, Nakai Y, Yamada T et al. Quantitative analysis of sensitivity to a Wnt3a gradient in determination of the pole-to-pole axis of mitotic cells by using a microfluidic device. FEBS Open Bio 2018-09-16 [PMID: 30524943] (ICC/IF, Human)
• Mazo G, Soplop N, Wang WJ et al. Spatial Control of Primary Ciliogenesis by Subdistal Appendages Alters Sensation-Associated Properties of Cilia Developmental Cell 2016-11-01 [PMID: 27818179] (Immunocytochemistry/ Immunofluorescence, Human)
• Xu Q, Zhang Y, Wei Q et al. Phosphatidylinositol phosphate kinase PIPKIgamma and phosphatase INPP5E coordinate initiation of ciliogenesis. Nat Commun 2016-02-26 [PMID: 26916822] (WB)
• Alby C, Piquand K, Huber C et al. Mutations in KIAA0586 Cause Lethal Ciliopathies Ranging from a Hydrolethalus Phenotype to Short-Rib Polydactyly Syndrome. Am J Hum Genet 2015-08-06 [PMID: 26166481]
• Failler M, Gee HY, Krug P et al. Mutations of CEP83 Cause Infantile Nephronophthisis and Intellectual Disability. Am J Hum Genet 2014-06-05 [PMID: 24882706] (ICC/IF, Human)
• Xu Q, Zhang Y, Xiong X et al. Type Igamma phosphatidylinositol phosphate kinase targets to the centrosome and restrains centriole duplication. J Cell Sci. 2014-01-16 [PMID: 24434581]
• Wei Q, Xu Q, Zhang Y et al. Transition fibre protein FBF1 is required for the ciliary entry of assembled intraflagellar transport complexes. Nat Commun. 2013-11-15 [PMID: 24231678] (IF/IHC, ICC/IF, C. elegans)
• Tanos BE, Yang HJ, Soni R et al. Centriole distal appendages promote membrane docking, leading to cilia initiation. Genes Dev 2013-01-15 [PMID: 23348840] (ICC/IF, Human)
• Izumi H, Kaneko Y. Evidence of asymmetric cell division and centrosome inheritance in human neuroblastoma cells Proc Natl Acad Sci 2012-10-11 [PMID: 23064640] (ICC/IF, Human)

Reviews for ODF2 Antibody (H00004957-M01) (2)

Average Rating: 5

(Based on 2 reviews)

We have 2 reviews tested in 1 species: Human.

reviewed by: Verified Customer IF Human 04/09/2019

Summary

• Application: Immunofluorescence
• Sample Tested: hTERT RPE-1 cell line from ATCC,RPE1 cells
• Species: Human
• Lot: G9131-1A1

Comments

• Comments: Fix by cold MEOH for 10 mins. Block with 3% BSA for 0.5 hours at room temperature.
  Dilute the ab at 1:100 in 3% BSA and incubate with cells for 2 hours at room temperature.

reviewed by: Verified Customer ICC Human 08/25/2010

Summary

• Application: Immunocytochemistry
• Sample Tested: hTERT RPE-1 cell line from ATCC
• Species: Human

Bioinformatics

• Gene Symbol: ODF2
• Entrez:
  • 4957(Human)
• Uniprot:
  • NP_002531(Human)