TCF7/TCF1 Antibody

Images

 
Western Blot: TCF7/TCF1 Antibody [NBP2-57570] - Western blot analysis in human cell line RT-4, human cell line U-251 MG and human plasma.
Immunocytochemistry/ Immunofluorescence: TCF7/TCF1 Antibody [NBP2-57570] - Staining of human cell line Hep G2 shows localization to nucleoplasm.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TCF7/TCF1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAK
Specificity
Specificity of human TCF7/TCF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TCF7
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
TCF7/TCF1 Knockout HeLa Cell Lysate
Control Peptide
TCF7/TCF1 Recombinant Protein Antigen (NBP2-57570PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for TCF7/TCF1 Antibody

  • FLJ36364
  • MGC47735
  • T-cell factor 1
  • T-cell specific
  • TCF1
  • TCF7
  • TCF-7
  • transcription factor 7 (T-cell specific, HMG-box)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00051176-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, PLA, RNAi, S-ELISA
NBP1-89679
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, PAGE
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00006934-M06
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-89680
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, ChIP
AF6116
Species: Hu
Applications: WB, ICC
H00006925-M03
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP1-33144
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7650
Species: Mu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-57570
Species: Hu
Applications: WB, ICC/IF

Publications for TCF7/TCF1 Antibody (NBP2-57570) (0)

There are no publications for TCF7/TCF1 Antibody (NBP2-57570).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCF7/TCF1 Antibody (NBP2-57570) (0)

There are no reviews for TCF7/TCF1 Antibody (NBP2-57570). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TCF7/TCF1 Antibody (NBP2-57570) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TCF7/TCF1 Products

Bioinformatics Tool for TCF7/TCF1 Antibody (NBP2-57570)

Discover related pathways, diseases and genes to TCF7/TCF1 Antibody (NBP2-57570). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCF7/TCF1 Antibody (NBP2-57570)

Discover more about diseases related to TCF7/TCF1 Antibody (NBP2-57570).
 

Pathways for TCF7/TCF1 Antibody (NBP2-57570)

View related products by pathway.

PTMs for TCF7/TCF1 Antibody (NBP2-57570)

Learn more about PTMs related to TCF7/TCF1 Antibody (NBP2-57570).
 

Research Areas for TCF7/TCF1 Antibody (NBP2-57570)

Find related products by research area.

Blogs on TCF7/TCF1

There are no specific blogs for TCF7/TCF1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCF7/TCF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TCF7