TCF7/TCF1 Antibody - BSA Free

Western Blot: TCF7/TCF1 Antibody [NBP2-57570] - Western blot analysis in human cell line RT-4, human cell line U-251 MG and human plasma.

Immunocytochemistry/Immunofluorescence: TCF7/TCF1 Antibody [NBP2-57570] - Staining of human cell line Hep G2 shows localization to nucleoplasm.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TCF7/TCF1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TCF7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TCF7/TCF1 Recombinant Protein Antigen (NBP2-57570PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TCF7/TCF1 Antibody - BSA Free

• FLJ36364
• MGC47735
• T-cell factor 1
• T-cell specific
• TCF1
• TCF7
• TCF-7
• transcription factor 7 (T-cell specific, HMG-box)

Background

The T cell specific transcription factor TCF7 activates genes involved in immune regulation and is a candidate locus for genetic susceptibility to type 1 diabetes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TCF7