TCF20 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TCF20 Antibody [NBP2-31968] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry: TCF20 Antibody [NBP2-31968] - Staining of human cerebellum shows distinct cytoplasmic and nuclear positivity in Purkinje cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TCF20 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SEGSSQPEEQLKSPMAESLDGGCSSSSEDQGERVRQLSGQSTSSDTTYKGGASEKAGSSPAQGAQNEPPRLNASPAAREEATSPGAKDMPLSSDGNPKVNEKTVGVIVS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TCF20
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TCF20 Protein (NBP2-31968PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TCF20 Antibody

  • transcription factor 20
  • AR1
  • SPBP
  • transcription factor 20 (AR1)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-90233
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00000126-D01P
Species: Hu, Mu
Applications: WB
NBP2-00649
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-45335
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00000130-M01
Species: Hu
Applications: WB, ELISA
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
AF5739
Species: Hu, Mu, Rt
Applications: WB

Publications for TCF20 Antibody (NBP2-31968) (0)

There are no publications for TCF20 Antibody (NBP2-31968).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCF20 Antibody (NBP2-31968) (0)

There are no reviews for TCF20 Antibody (NBP2-31968). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TCF20 Antibody (NBP2-31968). (Showing 1 - 1 of 1 FAQ).

  1. The datasheet says that the concentration of NBP2-31968 varies between lots, would you please help check and suggest the info about the latest lot?
    • Lot# R33995 is the current lot of TCF20 Antibody [NBP2-31968] and for this lot, the concentration is 0.2 mg/ml. This product is guaranteed for IHC-P and ICC-IF applications and the customer can see the suggested dilutions on the datasheet.

Secondary Antibodies

 

Isotype Controls

Additional TCF20 Products

Bioinformatics Tool for TCF20 Antibody (NBP2-31968)

Discover related pathways, diseases and genes to TCF20 Antibody (NBP2-31968). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCF20 Antibody (NBP2-31968)

Discover more about diseases related to TCF20 Antibody (NBP2-31968).
 

Pathways for TCF20 Antibody (NBP2-31968)

View related products by pathway.

PTMs for TCF20 Antibody (NBP2-31968)

Learn more about PTMs related to TCF20 Antibody (NBP2-31968).

Blogs on TCF20

There are no specific blogs for TCF20, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCF20 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TCF20
Uniprot