TCF-3/E2A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TCF-3/E2A Antibody [NBP2-38611] - Immunofluorescent staining of human cell line MCF7 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: TCF-3/E2A Antibody [NBP2-38611] - Staining of human lymph node shows strong nuclear positivity in non - germinal center cells.
Immunohistochemistry-Paraffin: TCF-3/E2A Antibody [NBP2-38611] - Staining of human lymph node shows no positivity in germinal center cells.
Immunohistochemistry-Paraffin: TCF-3/E2A Antibody [NBP2-38611] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: TCF-3/E2A Antibody [NBP2-38611] - Staining of human pancreas shows strong nuclear positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TCF-3/E2A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYYPS
Specificity
Specificity of human TCF-3/E2A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TCF3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TCF-3/E2A Protein (NBP2-38611PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TCF-3/E2A Antibody

  • bHLHb21
  • bHLHb21TCF-3
  • Class B basic helix-loop-helix protein 21
  • E2A immunoglobulin enhancer-binding factor E12/E47
  • E2A
  • E2AKappa-E2-binding factor
  • Immunoglobulin enhancer-binding factor E12/E47
  • Immunoglobulin transcription factor 1
  • ITF1
  • ITF1Transcription factor ITF-1
  • Kappa-E2-binding factor
  • MGC129647
  • MGC129648
  • Pan2
  • TCF-3
  • Tcfe2a
  • transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47)
  • Transcription factor 3
  • transcription factor E2-alpha
  • VDIR
  • VDR interacting repressor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6116
Species: Hu
Applications: WB, ICC
NBP2-13957
Species: Hu
Applications: IHC, IHC-P
H00006938-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-66897
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-33757
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
AF5165
Species: Hu, Mu
Applications: WB
H00006925-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-19083
Species: Hu
Applications: WB, ICC/IF
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-38790
Species: Hu
Applications: IHC, IHC-P
NBP2-02136
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-27194
Species: Hu, Rt, Bv, Ch, Eq, Ha, Pm
Applications: WB, ICC/IF
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-89679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TCF-3/E2A Antibody (NBP2-38611) (0)

There are no publications for TCF-3/E2A Antibody (NBP2-38611).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCF-3/E2A Antibody (NBP2-38611) (0)

There are no reviews for TCF-3/E2A Antibody (NBP2-38611). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TCF-3/E2A Antibody (NBP2-38611) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TCF-3/E2A Antibody (NBP2-38611)

Discover related pathways, diseases and genes to TCF-3/E2A Antibody (NBP2-38611). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCF-3/E2A Antibody (NBP2-38611)

Discover more about diseases related to TCF-3/E2A Antibody (NBP2-38611).
 

Pathways for TCF-3/E2A Antibody (NBP2-38611)

View related products by pathway.

PTMs for TCF-3/E2A Antibody (NBP2-38611)

Learn more about PTMs related to TCF-3/E2A Antibody (NBP2-38611).
 

Research Areas for TCF-3/E2A Antibody (NBP2-38611)

Find related products by research area.

Blogs on TCF-3/E2A

There are no specific blogs for TCF-3/E2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCF-3/E2A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TCF3
Entrez
Uniprot