TBC1D4 Antibody - BSA Free

Immunohistochemistry-Paraffin: TBC1D4 Antibody [NBP2-38880] - Staining of human adrenal gland shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TBC1D4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MEPPSCIQDEPFPHPLEPEPGVSAQPGPGKPSDKRFRLWYVGGSCLDHRTTLPMLPWLMAEIRRRSQKPE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TBC1D4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TBC1D4 Protein (NBP2-38880PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TBC1D4 Antibody - BSA Free

• Akt substrate of 160 kDa
• AS160Acrg embryonic lethality minimal region ortholog
• DKFZp779C0666
• KIAA0603TBC (Tre-2, BUB2, CDC16) domain-containing protein
• TBC1 domain family member 4
• TBC1 domain family, member 4

Background

AS160, also known as TBC1D4, is a 160 kDa Akt substrate that plays a critical role in regulating insulin-stimulated exocytosis of glucose transporter GLUT4. AS-160 contains a Rab GTPase-activating protein domain (GAP), suggesting its potential role in membrane trafficking. Insulin-stimulated phosphorylation of AS160 on threonine 642 is critical for mediating GLUT4 translocation in fat and muscle cells, via inactivation of Rab GAP function. Phosphorylation of Thr642 is also important in mediating TBC1D4 redistribution from low density microsomes to the cytosol in adipocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TBC1D4
• Uniprot:
  • O60343(Human)