TBC1D1 Antibody

Images

 
Western Blot: TBC1D1 Antibody [NBP1-54654] - Antibody Titration: 1 ug/ml Human heart.
Immunohistochemistry-Paraffin: TBC1D1 Antibody [NBP1-54654] - Human Kidney tissue, 5 ug/ml.
Western Blot: TBC1D1 Antibody [NBP1-54654] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.
Western Blot: TBC1D1 Antibody [NBP1-54654] - Sample Tissue: Human ACHN Antibody Dilution: 1.0 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TBC1D1 Antibody Summary

Immunogen
Synthetic peptides corresponding to TBC1D1(TBC1 (tre-2/USP6, BUB2, cdc16) domain family, member 1) The peptide sequence was selected from the middle region of TBC1D1. Peptide sequence RGSPGVSQRKLMRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRHSW. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TBC1D1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against TBC1D1 and was validated on Western blot.
Theoretical MW
133 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TBC1D1 Antibody

  • KIAA1108TBC
  • TBC1 (tre-2/USP6, BUB2, cdc16) domain family, member 1
  • TBC1 domain family member 1
  • TBC1

Background

TBC1D1 is the founding member of a family of proteins sharing a 180- to 200-amino acid TBC domain presumed to have a role in regulating cell growth and differentiation. These proteins share significant homology with TRE2 (USP6), yeast Bub2, and CDC16.TBC1D1 is the founding member of a family of proteins sharing a 180- to 200-amino acid TBC domain presumed to have a role in regulating cell growth and differentiation. These proteins share significant homology with TRE2 (USP6; MIM 604334), yeast Bub2, and CDC16 (MIM 603461) (White et al., 2000 [PubMed 10965142]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-225 BC050321.1 13-237 226-950 BC050321.1 896-1620 951-1020 BC028196.1 226-295 1021-1123 BC029950.1 255-357 1124-1433 BC028196.1 399-708 1434-1608 BC029950.1 668-842 1609-4133 BC053648.1 437-2961 4134-5688 AK074954.1 1433-2987

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-74462
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, CyTOF-ready
NBP2-76350
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
NBP1-49533
Species: Hu, Mu, Rt, Pl
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KD
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67820
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
H00005564-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-95244
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37322
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-92630
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36551
Species: Hu, Mu
Applications: WB, IP
NBP2-67232
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67165
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-54654
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TBC1D1 Antibody (NBP1-54654) (0)

There are no publications for TBC1D1 Antibody (NBP1-54654).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBC1D1 Antibody (NBP1-54654) (0)

There are no reviews for TBC1D1 Antibody (NBP1-54654). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TBC1D1 Antibody (NBP1-54654) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TBC1D1 Products

Bioinformatics Tool for TBC1D1 Antibody (NBP1-54654)

Discover related pathways, diseases and genes to TBC1D1 Antibody (NBP1-54654). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBC1D1 Antibody (NBP1-54654)

Discover more about diseases related to TBC1D1 Antibody (NBP1-54654).
 

Pathways for TBC1D1 Antibody (NBP1-54654)

View related products by pathway.

PTMs for TBC1D1 Antibody (NBP1-54654)

Learn more about PTMs related to TBC1D1 Antibody (NBP1-54654).

Blogs on TBC1D1.

Muscle-specific UBE2O ablation requires activated AMPK alpha 2 to protect against metabolic syndrome
By Jamshed Arslan, Pharm. D., PhD. Generating energy (ATP) from nutrients is a recipe for life. One of the sensors of cellular energy levels is the serine/threonine kinase AMPK. This enzyme facilitates lipid oxidati...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TBC1D1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TBC1D1
Uniprot