TANK Antibody - BSA Free

Immunohistochemistry-Paraffin: TANK Antibody [NBP2-38357] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TANK Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TANK Antibody - BSA Free (NBP2-38357) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: IRTTLDRAACLPPGDHNALYVNSFPLLDPSDAPFPSLDSPGKAIRGPQQPIWKPFPNQDSDSVVLSGTDSELHIPRVCEFCQAVFPPSIT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TANK
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TANK Protein (NBP2-38357PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TANK Antibody - BSA Free

• ITRAF
• I-TRAF
• I-TRAFTRAF2
• TANK
• TRAF family member-associated NF-kappa-B activator
• TRAF family member-associated NFKB activator
• TRAF-interacting protein

Background

The TRAF (tumor necrosis factor receptor-associated factor) family of proteins associate with and transduce signals from members of the tumor necrosis factor receptor (TNFR) superfamily. TANK/I-TRAF (TRAF family member associated NF-kB activator/TRAF-interacting protein) that was first defined as a novel TRAF-interacting protein that regulates TRAF-mediated signal transduction (reviewed in Bonif 2006). TANK/I-TRAF is thought to inhibit TRAF function by sequestering the TRAFs in the cytoplasm, thereby blocking their recruitment to the TNFR. TANK/I-TRAF has also been shown to bind to other proteins in the NF-kB signaling pathway, including NEMO. However, the role and different functions of TANK/I-TRAF in NF-kB signaling pathways remains to be fully elucidated. Recognizes TANK/I-TRAF, human TANK/I-TRAF is a 425 amino acid protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TANK
• Uniprot:
  • Q92844(Human)