TANK Antibody

Images

 
Immunohistochemistry: TANK Antibody [NBP2-38357] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TANK Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: IRTTLDRAACLPPGDHNALYVNSFPLLDPSDAPFPSLDSPGKAIRGPQQPIWKPFPNQDSDSVVLSGTDSELHIPRVCEFCQAVFPPSIT
Specificity
Specificity of human TANK antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TANK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TANK Protein (NBP2-38357PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TANK Antibody

  • ITRAF
  • I-TRAF
  • I-TRAFTRAF2
  • TANK
  • TRAF family member-associated NF-kappa-B activator
  • TRAF family member-associated NFKB activator
  • TRAF-interacting protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC-P
NBP2-26506
Species: Hu, Mu, Rt
NB100-56170
Species: Hu, Bv, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56176
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NB100-56178
Species: Hu, Mu, Rt, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF8181
Species: Hu
Applications: WB, Simple Western, IHC, KO
AF2658
Species: Hu
Applications: WB, IHC, ICC
AF6027
Species: Hu
Applications: WB
NBP1-27972
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38357
Species: Hu
Applications: IHC, IHC-P

Publications for TANK Antibody (NBP2-38357) (0)

There are no publications for TANK Antibody (NBP2-38357).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TANK Antibody (NBP2-38357) (0)

There are no reviews for TANK Antibody (NBP2-38357). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TANK Antibody (NBP2-38357) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TANK Antibody (NBP2-38357)

Discover related pathways, diseases and genes to TANK Antibody (NBP2-38357). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TANK Antibody (NBP2-38357)

Discover more about diseases related to TANK Antibody (NBP2-38357).
 

Pathways for TANK Antibody (NBP2-38357)

View related products by pathway.

PTMs for TANK Antibody (NBP2-38357)

Learn more about PTMs related to TANK Antibody (NBP2-38357).
 

Research Areas for TANK Antibody (NBP2-38357)

Find related products by research area.

Blogs on TANK

There are no specific blogs for TANK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TANK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TANK
Uniprot