HGK/MAP4K4 Antibody - BSA Free

Western Blot: HGK/MAP4K4 Antibody [NBP1-58853] - Sample Tissue: Human Stomach Tumor Antibody Dilution: 1.0 ug/ml

Immunohistochemistry: HGK/MAP4K4 Antibody [NBP1-58853] - Liver

Western Blot: HGK/MAP4K4 Antibody [NBP1-58853] - Titration: 0.2-1 ug/ml, Positive Control: Human Small Intestine.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

HGK/MAP4K4 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to MAP4K4(mitogen-activated protein kinase kinase kinase kinase 4) The peptide sequence was selected from the N terminal of MAP4K4. Peptide sequence PFIRDQPNERQVRIQLKDHIDRTRKKRGEKDETEYEYSGSEEEEEEVPEQ. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAP4K4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for HGK/MAP4K4 Antibody - BSA Free

• EC 2.7.11
• EC 2.7.11.1
• FLH21957
• FLJ10410
• hepatocyte progenitor kinase-like/germinal center kinase-like kinase
• HGK
• HGKFLJ20373
• HPK/GCK-like kinase HGK
• KIAA0687
• MAP4K4
• MAPK/ERK kinase kinase kinase 4
• MEK kinase kinase 4
• MEKKK 4
• MEKKK4
• mitogen-activated protein kinase kinase kinase kinase 4
• Nck-interacting kinase
• NIKFLJ90111

Background

MAP4K4 is the serine/threonine kinase that may play a role in the response to environmental stress and cytokines such as TNF-alpha. MAP4K4 appears to act upstream of the JUN N-terminal pathway.The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase has been shown to specifically activate MAPK8/JNK. The activation of MAPK8 by this kinase is found to be inhibited by the dominant-negative mutants of MAP3K7/TAK1, MAP2K4/MKK4, and MAP2K7/MKK7, which suggests that this kinase may function through the MAP3K7-MAP2K4-MAP2K7 kinase cascade, and mediate the TNF-alpha signaling pathway. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HGK/MAP4K4 Antibody (NBP1-58853)(1)

Publication using NBP1-58853

• Li J, Shi S, et al. FGFR1 is critical for the anti-endothelial mesenchymal transition effect of N-acetyl-seryl-aspartyl-lysyl-proline via induction of the MAP4K4 pathway. Cell Death Dis 2017-08-03 [PMID: 28771231] (WB, Rabbit)

Bioinformatics

• Gene Symbol: MAP4K4