Syndecan-2/CD362 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Syndecan-2/CD362 Antibody [NBP2-58489] - Staining of human cell line Hep G2 shows localization to plasma membrane & cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Syndecan-2/CD362 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVL
Specificity
Specificity of human Syndecan-2/CD362 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SDC2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Syndecan-2/CD362 Recombinant Protein Antigen (NBP2-58489PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Syndecan-2/CD362 Antibody

  • CD362 antigen
  • CD362
  • Fibroglycan
  • heparan sulfate proteoglycan 1, cell surface-associated
  • Heparan sulfate proteoglycan core protein
  • HSPG
  • HSPG1
  • HSPG1syndecan proteoglycan 2
  • SDC2
  • SYND2
  • SYND2cell surface-associated heparan sulfate proteoglycan 1
  • syndecan 2
  • Syndecan2
  • Syndecan-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-41551
Species: Hu, Mu, Rt, Ch
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37483
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-33197
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB600-1287
Species: Hu, Mu, Rt, Rb
Applications: WB, Flow, IHC, IP, CyTOF-ready
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-58489
Species: Hu
Applications: ICC/IF

Publications for Syndecan-2/CD362 Antibody (NBP2-58489) (0)

There are no publications for Syndecan-2/CD362 Antibody (NBP2-58489).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Syndecan-2/CD362 Antibody (NBP2-58489) (0)

There are no reviews for Syndecan-2/CD362 Antibody (NBP2-58489). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Syndecan-2/CD362 Antibody (NBP2-58489) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Syndecan-2/CD362 Products

Bioinformatics Tool for Syndecan-2/CD362 Antibody (NBP2-58489)

Discover related pathways, diseases and genes to Syndecan-2/CD362 Antibody (NBP2-58489). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Syndecan-2/CD362 Antibody (NBP2-58489)

Discover more about diseases related to Syndecan-2/CD362 Antibody (NBP2-58489).
 

Pathways for Syndecan-2/CD362 Antibody (NBP2-58489)

View related products by pathway.

PTMs for Syndecan-2/CD362 Antibody (NBP2-58489)

Learn more about PTMs related to Syndecan-2/CD362 Antibody (NBP2-58489).
 

Research Areas for Syndecan-2/CD362 Antibody (NBP2-58489)

Find related products by research area.

Blogs on Syndecan-2/CD362

There are no specific blogs for Syndecan-2/CD362, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Syndecan-2/CD362 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SDC2