Synaptotagmin 1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Synaptotagmin 1 Antibody [NBP2-34215] - Analysis in human cerebral cortex and pancreas tissues using NBP2-34215 antibody. Corresponding Synaptotagmin 1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Synaptotagmin 1 Antibody [NBP2-34215] - Staining of human cerebellum, liver, pancreas and testis using Anti-Synaptotagmin 1 antibody NBP2-34215 (A) shows similar protein distribution across tissues to independent antibody NBP1-87362 (B).

Western Blot: Synaptotagmin 1 Antibody [NBP2-34215] - Analysis in control (vector only transfected HEK293T lysate) and SYT1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: Synaptotagmin 1 Antibody [NBP2-34215] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: Synaptotagmin 1 Antibody [NBP2-34215] - Staining of human liver.

Immunohistochemistry-Paraffin: Synaptotagmin 1 Antibody [NBP2-34215] - Staining of human testis.

Immunohistochemistry-Paraffin: Synaptotagmin 1 Antibody [NBP2-34215] - Staining of human cerebral cortex using Anti-SYT1 antibody NBP2-34215.

Immunohistochemistry-Paraffin: Synaptotagmin 1 Antibody [NBP2-34215] - Staining of human pancreas using Anti-SYT1 antibody NBP2-34215.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Synaptotagmin 1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MVSESHHEALAAPPVTTVATVLPSNATEPASPGEGKEDAFSKLKEKFMNELH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SYT1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Synaptotagmin 1 Recombinant Protein Antigen (NBP2-34215PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Synaptotagmin 1 Antibody - BSA Free

• DKFZp781D2042
• P65
• SVP65
• synaptotagmin Isynaptotagmin 1
• Synaptotagmin1
• Synaptotagmin-1
• SYT
• SYT1
• sytI

Background

Synaptotagmin is widely regarded as the primary calcium sensor for synaptic vesicle exocytosis (Fernandez-Chacon et al., 2001; Wang et al., 2003). Moreover recent studies indicate that the protein also plays a key role in endocytosis (Poskanzer et al., 2003). Synaptotagmin can be phosphorylated by multiple protein kinases and this may play a key role in modulation of synaptotagmin ability to influence both the exocytotic and endocytotic components of synaptic transmission (Hilfiker et al., 1999; Lee et al., 2004).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SYT1
• Uniprot:
  • P21579(Human)