Recombinant Human SUV39H2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SUV39H2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-350 of Human SUV39H2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MEYYLVKWKGWPDSTNTWEPLQNLKCPLLLQQFSNDKHNYLSQVKKGKAITPKDNNKTLKPAIAEYIVKKAKQRIALQRWQDELNRRKNHKGMIFVENTVDLEGPPSDFYYINEYKPAPGISLVNEATFGCSCTDCFFQKCCPAEAGVLLAYNKNQQIKIPPGTPIYECNSRCQCGPDCPNRIVQKGTQYSLCIFRTSNGRGWGVKTLVKIKRMSFVMEYVGEVITSEEAERRGQFYDNKGITYLFDLDYESDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRTVCKCGAVTCRGYLN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
SUV39H2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SUV39H2 Protein

  • FLJ23414Histone H3-K9 methyltransferase 2
  • H3-K9-HMTase 2
  • histone-lysine N-methyltransferase SUV39H2
  • KMT1BEC 2.1.1.43
  • Lysine N-methyltransferase 1B
  • Su(var)3-9 homolog 2
  • suppressor of variegation 3-9 homolog 2 (Drosophila)
  • Suppressor of variegation 3-9 homolog 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-17086
Species: Hu, Mu, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
PP-A8620A-00
Species: Hu, Mu
Applications: WB, IHC, IP, DirELISA
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20322
Species: Hu
Applications: WB, ChIP, IP
NB100-56664
Species: Hu, Mu
Applications: WB, ChIP, IHC-P
NBP2-22152
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
PP-B0422-00
Species: Hu, Mu
Applications: WB, IHC, IP, DirELISA
NBP2-29965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-89843
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89644
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-40585
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
NBP2-20430
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IP
NB100-1762
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ChIP, ELISA, IHC, IHC-P
NB600-248
Species: Hu
Applications: WB, IP
H00008850-M04
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for SUV39H2 Recombinant Protein (H00079723-P01) (0)

There are no publications for SUV39H2 Recombinant Protein (H00079723-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SUV39H2 Recombinant Protein (H00079723-P01) (0)

There are no reviews for SUV39H2 Recombinant Protein (H00079723-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SUV39H2 Recombinant Protein (H00079723-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SUV39H2 Products

Bioinformatics Tool for SUV39H2 Recombinant Protein (H00079723-P01)

Discover related pathways, diseases and genes to SUV39H2 Recombinant Protein (H00079723-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUV39H2 Recombinant Protein (H00079723-P01)

Discover more about diseases related to SUV39H2 Recombinant Protein (H00079723-P01).
 

Pathways for SUV39H2 Recombinant Protein (H00079723-P01)

View related products by pathway.

PTMs for SUV39H2 Recombinant Protein (H00079723-P01)

Learn more about PTMs related to SUV39H2 Recombinant Protein (H00079723-P01).
 

Research Areas for SUV39H2 Recombinant Protein (H00079723-P01)

Find related products by research area.

Blogs on SUV39H2

There are no specific blogs for SUV39H2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SUV39H2 Antibody
NB100-1140

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SUV39H2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SUV39H2