Surfactant Protein A Antibody - BSA Free

Immunohistochemistry-Paraffin: Surfactant Protein A Antibody [NBP2-46679] - Analysis in human lung and liver tissues using NBP2-46679 antibody. Corresponding SFTPA1 RNA-seq data are presented for the same tissues.

Western Blot: Surfactant Protein A Antibody [NBP2-46679] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10, Lane 2: Human cell line RT-4, Lane 3: Human cell line U-251 MG, Lane 4: Human plasma

Immunohistochemistry-Paraffin: Surfactant Protein A Antibody [NBP2-46679] - Staining of human Lung shows strong cytoplasmic positivity in pneumocytes.

Immunohistochemistry-Paraffin: Surfactant Protein A Antibody [NBP2-46679] - Staining of human rectum shows no positvity in glanular cells as expected.

Immunohistochemistry-Paraffin: Surfactant Protein A Antibody [NBP2-46679] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Surfactant Protein A Antibody [NBP2-46679] - Staining of human kidney shows no postivity in cells in tubules as expected.

Immunohistochemistry-Paraffin: Surfactant Protein A Antibody [NBP2-46679] - Analysis in human lung and liver tissues using NBP2-46679 antibody. Corresponding SFTPA1 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Surfactant Protein A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Surfactant Protein A Antibody - BSA Free (NBP2-46679) is a polyclonal antibody validated for use in IHC and WB. Anti-Surfactant Protein A Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SFTPA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 µg/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Surfactant Protein A Recombinant Protein Antigen (NBP2-46679PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Surfactant Protein A Antibody - BSA Free

• COLEC4
• PSAP
• PSPA
• PSP-A
• SFTP1
• SFTPA1
• SFTPA1B
• SPA
• SP-A
• SPA1
• SP-A1
• surfactant protein A1B

Background

Surfactant protein A is a protein with two isoforms, with lengths of 248 and 263 amino acids and weights of approximately 26 and 28 kDa respectively. Surfactant protein A binds to surfactant phospholipids in the presence of calcium ions and helps lower the surface tension in the alveoli of the lungs. Current research is being done on several diseases and disorders linked to this protein including pulmonary fibrosis, allergic bronchopulmonary aspergillosis, pulmonary alveolar proteinosis, non-small cell lung carcinoma, sclerosing hemangioma, otitis media, chronic obstructive pulmonary disease, bronchitis obliterans, bronchopulmonary dysplasia, rhinitis, aspergillosis, pulmonary edema, insulin resistance, and pneumoconiosis. Surfactant protein A has also been shown to have interactions with DMBT1, MYO18A, C1QA, SFTPD, and TLR2 in pathways such as the immune response, bacterial infections in CF airways, cell-cell communication, phagosome, and pertussis pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Surfactant Protein A Antibody (NBP2-46679)(1)

Publication using NBP2-46679

• Reisinger C, S�lkner J, Risser D, Seltenhammer M Diagnosis of asphyxiation in advanced decomposed corpses by using Oil-Red-O Stain and immunohistochemical technology Legal Medicine 2023-02-01 [PMID: 36905850] (IHC-P, IHC-P)
  
  Details:
  Dilution used in IHC-P 1:500

Bioinformatics

• Gene Symbol: SFTPA1
• Entrez:
  • 729238(Human)
• Uniprot:
  • Q8IWL1(Human)