COLEC5 Antibody

Images

 
Western Blot: COLEC5 Antibody [NBP1-98277] - Lanes: Lane 1: 25ng purified Human Alveolar sample (w/SP-A1+SP-A2) Lane 1: 25ng purified Human Alveolar sample (w/SP-A1+SP-A2) Lane 2: 20ug Rat bronchoalveolar lavage Lane 3: ...read more
Western Blot: COLEC5 Antibody [NBP1-98277] - Human Fetal Heart Lysate, concentration 1 ug/ml.
Western Blot: COLEC5 Antibody [NBP1-98277] - 1: 20ng human SP-A2 protein 2: 20 ug rat wt BAL lysate, 3: 25 ng hSP-A2 (1A0) protein from transfected CHO lysate, 4: 25 ng hSP-A2 (1A1) protein from transfected CHO lysate, ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

COLEC5 Antibody Summary

Immunogen
The immunogen for this antibody is COLEC5 - N-terminal region. Peptide sequence PGNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQIL. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SFTPA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for COLEC5 Antibody

  • pulmonary surfactant-associated protein A2
  • COLEC5
  • PSAP
  • PSPA
  • PSP-A
  • SFTP1
  • SFTPA2B
  • SP-A
  • SPA2
  • SPAII
  • surfactant protein A2

Background

This gene is one of several genes encoding pulmonary-surfactant associated proteins (SFTPA) located on chromosome 10. Mutations in this gene and a highly similar gene located nearby, which affect the highly conserved carbohydrate recognition domain, are associated with idiopathic pulmonary fibrosis. The current version of the assembly displays only a single centromeric SFTPA gene pair rather than the two gene pairs shown in the previous assembly which were thought to have resulted from a duplication.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DSFPD0
Species: Hu
Applications: ELISA
NBP2-77431
Species: Hu
Applications: IHC, WB
NBP1-87201
Species: Hu
Applications: IHC, IHC-P, WB
MAB4077
Species: Hu
Applications: IHC, WB
NBP2-12928
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
MAB4218
Species: Hu
Applications: IHC, WB
DKK300
Species: Hu
Applications: ELISA
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
AF2307
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
251-KG/CF
Species: Hu
Applications: BA
NBP1-32920
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF4036
Species: Hu
Applications: Simple Western, WB
H00005324-M02
Species: Hu, Mu
Applications: ChIP, ELISA, IHC, IHC-P, WB
NBP2-13669
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002629-M01
Species: Hu, Pl
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
D6050
Species: Hu
Applications: ELISA

Publications for COLEC5 Antibody (NBP1-98277) (0)

There are no publications for COLEC5 Antibody (NBP1-98277).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for COLEC5 Antibody (NBP1-98277) (0)

There are no reviews for COLEC5 Antibody (NBP1-98277). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for COLEC5 Antibody (NBP1-98277) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional COLEC5 Products

Array NBP1-98277

Bioinformatics Tool for COLEC5 Antibody (NBP1-98277)

Discover related pathways, diseases and genes to COLEC5 Antibody (NBP1-98277). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for COLEC5 Antibody (NBP1-98277)

Discover more about diseases related to COLEC5 Antibody (NBP1-98277).
 

Pathways for COLEC5 Antibody (NBP1-98277)

View related products by pathway.

PTMs for COLEC5 Antibody (NBP1-98277)

Learn more about PTMs related to COLEC5 Antibody (NBP1-98277).

Blogs on COLEC5

There are no specific blogs for COLEC5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our COLEC5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SFTPA2
Uniprot