COLEC5 Antibody

Western Blot: COLEC5 Antibody [NBP1-98277] - Lanes: Lane 1: 25ng purified Human Alveolar sample (w/SP-A1+SP-A2) Lane 1: 25ng purified Human Alveolar sample (w/SP-A1+SP-A2) Lane 2: 20ug Rat bronchoalveolar lavage Lane 3: 25ng hSP-A2 variant expressed in CHO cells Lane 4: 25ng hSP-A2 variant expressed

Western Blot: COLEC5 Antibody [NBP1-98277] - Human Fetal Heart Lysate, concentration 1 ug/ml.

Western Blot: COLEC5 Antibody [NBP1-98277] - 1: 20ng human SP-A2 protein 2: 20 ug rat wt BAL lysate, 3: 25 ng hSP-A2 (1A0) protein from transfected CHO lysate, 4: 25 ng hSP-A2 (1A1) protein from transfected CHO lysate, 5: 25 ng hSP-A1 (6A2) protein from transfected CHO lysate, 6: 25 ng hSP-A1 (6A4) protein from transfected CHO lysate, 7: 25 ng hSP-A2/1 (1A0/6A4) protein from transfected CHO lysate, 8: 25 ng hSP-A2/1 (1A1/6A2) protein from transfected CHO lysate, 9: 20 ug SP-A KO mouse BAL lysate, 10: 25 ng hSP-A2 (1A0) protein from transfected mouse BAL lysate, 11 : 25 ng hSP-A2 (1A1) protein from transfected mouse BAL lysate, 12: 25 ng hSP-A1 (6A2) protein from transfected mouse BAL lysate, 13: 25 ng hSP-A1 (6A4) protein from transfected mouse BAL lysate, 14: 25 ng hSP-A2/1 (1A0/6A2) protein from transfected mouse BAL lysate, 15: 25 ng mouse SP-A2 protein from mouse BAL lysate ,16: 20 ug mouse wt BAL lysate, 17: 15ug human wt T2 lysate, 18: 25 ng human SP-A2 protein.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

COLEC5 Antibody Summary

• Immunogen: The immunogen for this antibody is COLEC5 - N-terminal region. Peptide sequence PGNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQIL. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SFTPA2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for COLEC5 Antibody

• pulmonary surfactant-associated protein A2
• COLEC5
• PSAP
• PSPA
• PSP-A
• SFTP1
• SFTPA2B
• SP-A
• SPA2
• SPAII
• surfactant protein A2

Background

This gene is one of several genes encoding pulmonary-surfactant associated proteins (SFTPA) located on chromosome 10. Mutations in this gene and a highly similar gene located nearby, which affect the highly conserved carbohydrate recognition domain, are associated with idiopathic pulmonary fibrosis. The current version of the assembly displays only a single centromeric SFTPA gene pair rather than the two gene pairs shown in the previous assembly which were thought to have resulted from a duplication.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SFTPA2
• Uniprot:
  • NP_001092138(Human)