Sulfatase Modifying Factor 2/SUMF2 Antibody

Images

 
Immunohistochemistry-Paraffin: Sulfatase Modifying Factor 2/SUMF2 Antibody [NBP1-84145] - Staining of human gallbladder shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Sulfatase Modifying Factor 2/SUMF2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ATSMVQLQGGRFLMGTNSPDSRDGEGPVREATVKPFAIDIFPVTNKDFRDFVREKKYRTEAEMFGWSFVFEDFVSDELRNKATQPMKSVLWWLP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SUMF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Sulfatase Modifying Factor 2/SUMF2 Protein (NBP1-84145PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Sulfatase Modifying Factor 2/SUMF2 Antibody

  • C-alpha-formyglycine-generating enzyme 2
  • C-alpha-formylglycine-generating enzyme 2
  • DKFZp566I1024
  • DKFZp686I1024
  • DKFZp686L17160
  • DKFZp781L1035
  • FGE2
  • MGC99485
  • paralog of the formylglycine-generating enzyme
  • pFGE
  • sulfatase modifying factor 2
  • sulfatase-modifying factor 2
  • SUMF2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83905
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00347527-B01P
Species: Hu
Applications: WB, ELISA
AF2485
Species: Hu
Applications: WB, IHC, IP
NBP1-88838
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30451
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34951
Species: Hu
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB4675
Species: Mu
Applications: WB, IHC, Neut
NBP2-14306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92123
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6529
Species: Hu
Applications: WB, Simple Western
NBP2-20964
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3264
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-86240
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92629
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-53110
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84509
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-84145
Species: Hu
Applications: IHC, IHC-P

Publications for Sulfatase Modifying Factor 2/SUMF2 Antibody (NBP1-84145) (0)

There are no publications for Sulfatase Modifying Factor 2/SUMF2 Antibody (NBP1-84145).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sulfatase Modifying Factor 2/SUMF2 Antibody (NBP1-84145) (0)

There are no reviews for Sulfatase Modifying Factor 2/SUMF2 Antibody (NBP1-84145). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Sulfatase Modifying Factor 2/SUMF2 Antibody (NBP1-84145) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Sulfatase Modifying Factor 2/SUMF2 Products

Bioinformatics Tool for Sulfatase Modifying Factor 2/SUMF2 Antibody (NBP1-84145)

Discover related pathways, diseases and genes to Sulfatase Modifying Factor 2/SUMF2 Antibody (NBP1-84145). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sulfatase Modifying Factor 2/SUMF2 Antibody (NBP1-84145)

Discover more about diseases related to Sulfatase Modifying Factor 2/SUMF2 Antibody (NBP1-84145).
 

Pathways for Sulfatase Modifying Factor 2/SUMF2 Antibody (NBP1-84145)

View related products by pathway.

PTMs for Sulfatase Modifying Factor 2/SUMF2 Antibody (NBP1-84145)

Learn more about PTMs related to Sulfatase Modifying Factor 2/SUMF2 Antibody (NBP1-84145).

Blogs on Sulfatase Modifying Factor 2/SUMF2

There are no specific blogs for Sulfatase Modifying Factor 2/SUMF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sulfatase Modifying Factor 2/SUMF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SUMF2
Entrez