TMC3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TMC3 Antibody [NBP1-86240] - Staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: TMC3 Antibody [NBP1-86240] - Staining of human tonsil shows no positivity as expected.
Immunohistochemistry-Paraffin: TMC3 Antibody [NBP1-86240] - Staining of human duodenum shows distinct cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TMC3 Antibody [NBP1-86240] - Staining of human duodenum shows distinct cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TMC3 Antibody [NBP1-86240] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: TMC3 Antibody [NBP1-86240] - Staining of human parathyroid gland shows high expression.
Immunohistochemistry-Paraffin: TMC3 Antibody [NBP1-86240] - Analysis in human parathyroid gland and liver tissues using NBP1-86240 antibody. Corresponding TMC3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: TMC3 Antibody [NBP1-86240] - Staining of human parathyroid gland shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: TMC3 Antibody [NBP1-86240] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: TMC3 Antibody [NBP1-86240] - Staining of human duodenum shows no positivity in glandular cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMC3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RRNASQCYLYQESLLLSNLDDSFSADETGDSNDPEQIFQNIQFQKDLMANIRCRPWTMGQKLRALRQAKNIVLKFEGRLTRTRGYQAAG
Specificity
Specificity of human TMC3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TMC3 Protein (NBP1-86240PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMC3 Antibody

  • transmembrane channel-like 3
  • transmembrane channel-like protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76892
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-76903
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF7895
Species: Hu
Applications: WB, IHC
NBP3-05608
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-59417
Species: Hu
Applications: WB
NBP2-13437
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP1-86248
Species: Hu
Applications: WB, IHC, IHC-P
H00079175-B01P
Species: Hu
Applications: WB, ICC/IF
H00003703-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP, S-ELISA
NBP1-85466
Species: Hu, Mu, Fe
Applications: WB, IHC, IHC-P
AF3264
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-81880
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00004649-M04
Species: Hu
Applications: WB, ELISA, S-ELISA
PP-H7223-00
Species: Hu
Applications: WB, IHC, DirELISA
NBP2-48736
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3454
Species: Mu
Applications: WB, IP
H00010518-A01
Species: Hu, Ze
Applications: WB, ELISA
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-86240
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for TMC3 Antibody (NBP1-86240) (0)

There are no publications for TMC3 Antibody (NBP1-86240).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMC3 Antibody (NBP1-86240) (0)

There are no reviews for TMC3 Antibody (NBP1-86240). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TMC3 Antibody (NBP1-86240) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TMC3 Products

Array NBP1-86240

Bioinformatics Tool for TMC3 Antibody (NBP1-86240)

Discover related pathways, diseases and genes to TMC3 Antibody (NBP1-86240). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMC3 Antibody (NBP1-86240)

Discover more about diseases related to TMC3 Antibody (NBP1-86240).

Blogs on TMC3

There are no specific blogs for TMC3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMC3