MANF Antibody (1D10)

Images

 
Western Blot: MANF Antibody (1D10) [H00007873-M01] - Western Blot detection against Immunogen (33.33 KDa).
Immunocytochemistry/ Immunofluorescence: MANF Antibody (1D10) [H00007873-M01] - Analysis of monclonal antibody to MANF antibody on HeLa cell. Image from verified customer review.
Immunocytochemistry/ Immunofluorescence: MANF Antibody (1D10) [H00007873-M01] - Analysis of monoclonal antibody to MANF on HeLa cell . Antibody concentration 40 ug/ml.
Sandwich ELISA: MANF Antibody (1D10) [H00007873-M01] - Detection limit for recombinant GST tagged MANF is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
1D10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MANF Antibody (1D10) Summary

Immunogen
ARMET (NP_006001.2, 116 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASARTDL
Specificity
Reacts with arginine-rich, mutated in early stage tumors.
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MANF
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
  • Western Blot
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.
Reviewed Applications
Read 1 Review rated 5
using
H00007873-M01 in the following applications:

Publications
Read Publications using H00007873-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MANF Antibody (1D10)

  • Arginine-Rich Protein
  • arginine-rich, mutated in early stage tumors
  • ARMET
  • ARP
  • MANF
  • mesencephalic astrocyte-derived neurotrophic factor
  • Protein ARMET

Background

The protein encoded by this gene is localized in the endoplasmic reticulum (ER) and golgi, and is also secreted. Reducing expression of this gene increases susceptibility to ER stress-induced death and promotes cell proliferation. The protein was initially thought to be longer at the N-terminus and to contain an arginine-rich region but transcribed evidence indicates a smaller open reading frame that does not encode the arginine tract. The presence of a specific mutation changing the previously numbered codon 50 from ATG to AGG, or deletion of that codon, has been reported in a variety of solid tumors. With the protein size correction, this codon is now identified as the initiation codon. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010097-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP2-75395
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-30955
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
AF1444
Species: Mu
Applications: IHC, WB
NB300-996
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP1-82512
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NBP2-82648
Species: Hu
Applications: WB
NBP2-67632
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
212-GD/CF
Species: Hu
Applications: Bind, BA
NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
NBP1-76834
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
PP-H7147-00
Species: Hu
Applications: IHC, IP, WB
NBP3-13180
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF7388
Species: Hu
Applications: IHC
NB100-61628
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP (-), Simple Western, WB
H00057180-B01P
Species: Hu
Applications: WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP2-82073
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF3485
Species: Hu, Pm
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
H00007873-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA

Publications for MANF Antibody (H00007873-M01)(2)

Review for MANF Antibody (H00007873-M01) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00007873-M01:
Filter by Applications
Immunocytochemistry
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry MANF H00007873-M01
Enlarge
5
reviewed by:
Sarah Miller
Immunocytochemistry Human 01/03/2022
View

Summary

ApplicationImmunocytochemistry
Sample TestedHeLa cells
SpeciesHuman
Lot1D10

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MANF Antibody (H00007873-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MANF Products

Bioinformatics Tool for MANF Antibody (H00007873-M01)

Discover related pathways, diseases and genes to MANF Antibody (H00007873-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MANF Antibody (H00007873-M01)

Discover more about diseases related to MANF Antibody (H00007873-M01).
 

Pathways for MANF Antibody (H00007873-M01)

View related products by pathway.

PTMs for MANF Antibody (H00007873-M01)

Learn more about PTMs related to MANF Antibody (H00007873-M01).
 

Research Areas for MANF Antibody (H00007873-M01)

Find related products by research area.

Blogs on MANF

There are no specific blogs for MANF, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Sarah Miller
01/03/2022
Application: Immunocytochemistry
Species: Human

Bioinformatics

Gene Symbol MANF
Entrez
Uniprot