MANF Antibody (1D10)

Western Blot: MANF Antibody (1D10) [H00007873-M01] - Western Blot detection against Immunogen (33.33 KDa).

Immunocytochemistry/Immunofluorescence: MANF Antibody (1D10) [H00007873-M01] - Analysis of monclonal antibody to MANF antibody on HeLa cell. Image from verified customer review.

Immunocytochemistry/Immunofluorescence: MANF Antibody (1D10) [H00007873-M01] - Analysis of monoclonal antibody to MANF on HeLa cell . Antibody concentration 40 ug/ml.

Sandwich ELISA: MANF Antibody (1D10) [H00007873-M01] - Detection limit for recombinant GST tagged MANF is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 1D10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

MANF Antibody (1D10) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: ARMET (NP_006001.2, 116 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASARTDL
• Specificity: Reacts with arginine-rich, mutated in early stage tumors.
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MANF
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MANF Antibody (1D10)

• Arginine-Rich Protein
• arginine-rich, mutated in early stage tumors
• ARMET
• ARP
• MANF
• mesencephalic astrocyte-derived neurotrophic factor
• Protein ARMET

Background

The protein encoded by this gene is localized in the endoplasmic reticulum (ER) and golgi, and is also secreted. Reducing expression of this gene increases susceptibility to ER stress-induced death and promotes cell proliferation. The protein was initially thought to be longer at the N-terminus and to contain an arginine-rich region but transcribed evidence indicates a smaller open reading frame that does not encode the arginine tract. The presence of a specific mutation changing the previously numbered codon 50 from ATG to AGG, or deletion of that codon, has been reported in a variety of solid tumors. With the protein size correction, this codon is now identified as the initiation codon. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MANF Antibody (H00007873-M01)(2)

Publications using H00007873-M01

• Sun H, Jiang M, Fu X et al. Mesencephalic astrocyte-derived neurotrophic factor reduces cell apoptosis via upregulating HSP70 in SHSY-5Y cells. Transl Neurodegener 2017-05-22 [PMID: 28536652]
• Huang J, Chen C, Gu H et al. Mesencephalic astrocyte-derived neurotrophic factor reduces cell apoptosis via upregulating GRP78 in SH-SY5Y cells. Cell Biol Int 2016-07-01 [PMID: 27145383]

Review for MANF Antibody (H00007873-M01) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Sarah Miller ICC Human 01/03/2022

Summary

• Application: Immunocytochemistry
• Sample Tested: HeLa cells
• Species: Human
• Lot: 1D10

Bioinformatics

• Gene Symbol: MANF
• Entrez:
  • 7873(Human)
• Uniprot:
  • NP_006001(Human)