Reactivity | HuSpecies Glossary |
Applications | WB, ELISA, ICC/IF, S-ELISA |
Clone | 1D10 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Immunogen | ARMET (NP_006001.2, 116 a.a. ~ 185 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASARTDL |
Specificity | Reacts with arginine-rich, mutated in early stage tumors. |
Isotype | IgG1 Kappa |
Clonality | Monoclonal |
Host | Mouse |
Gene | MANF |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | This antibody is reactive against recombinant protein in WB and ELISA. |
|
Reviewed Applications |
|
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | In 1x PBS, pH 7.4 |
Preservative | No Preservative |
Purity | Protein A purified |
Images | Ratings | Applications | Species | Date | Details | ||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
![]() Enlarge |
reviewed by:
Sarah Miller |
Immunocytochemistry | Human | 01/03/2022 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for MANF Antibody (H00007873-M01)Discover more about diseases related to MANF Antibody (H00007873-M01).
| Pathways for MANF Antibody (H00007873-M01)View related products by pathway.
|
PTMs for MANF Antibody (H00007873-M01)Learn more about PTMs related to MANF Antibody (H00007873-M01).
| Research Areas for MANF Antibody (H00007873-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
Sarah Miller 01/03/2022 |
||
Application: | Immunocytochemistry | |
Species: | Human |