ZNF148 Antibody - BSA Free

Western Blot: ZNF148 Antibody [NBP2-94521] - Analysis of extracts of various cell lines, using ZNF148 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 60s.

Immunocytochemistry/Immunofluorescence: ZNF148 Antibody [NBP2-94521] - Immunofluorescence analysis of A-549 cells using ZNF148 antibody (NBP2-94521).

Immunohistochemistry-Paraffin: ZNF148 Antibody [NBP2-94521] - Paraffin-embedded rat liver using ZNF148 .

Western Blot: ZNF148 Antibody [NBP2-94521] - Paraffin-embedded mouse kidney using ZNF148 .

Western Blot: ZNF148 Antibody [NBP2-94521] - Paraffin-embedded rat lung using ZNF148 .

Immunohistochemistry-Paraffin: ZNF148 Antibody [NBP2-94521] - Paraffin-embedded human appendix using ZNF148 .

Immunohistochemistry-Paraffin: ZNF148 Antibody [NBP2-94521] - Paraffin-embedded human colon using ZNF148 .

Immunohistochemistry-Paraffin: ZNF148 Antibody [NBP2-94521] - Paraffin-embedded human lung using ZNF148 .

Immunohistochemistry-Paraffin: ZNF148 Antibody [NBP2-94521] - Paraffin-embedded human smooth muscle using ZNF148 .

Immunohistochemistry-Paraffin: ZNF148 Antibody [NBP2-94521] - Paraffin-embedded mouse brain using ZNF148 .

Immunohistochemistry-Paraffin: ZNF148 Antibody [NBP2-94521] - Paraffin-embedded mouse heart using ZNF148 .

Immunohistochemistry-Paraffin: ZNF148 Antibody [NBP2-94521] - Paraffin-embedded mouse liver using ZNF148 .

Immunohistochemistry-Paraffin: ZNF148 Antibody [NBP2-94521] - Paraffin-embedded mouse lung using ZNF148 .

Immunohistochemistry-Paraffin: ZNF148 Antibody [NBP2-94521] - Paraffin-embedded rat brain using ZNF148 .

Immunohistochemistry-Paraffin: ZNF148 Antibody [NBP2-94521] - Paraffin-embedded rat heart using ZNF148 .

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZNF148 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 690-794 of human ZNF148 (NP_068799.2). SGDETNHASATSTQDFLDQVTSQKKAEAQPVHQAYQMSSFEQPFRAPYHGSRAGIATQFSTANGQVNLRGPGTSAEFSEFPLVNVNDNRAGMTSSPDATTGQTFG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF148
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 1:20 - 1:100
  • Immunohistochemistry 1:50-1:100
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZNF148 Antibody - BSA Free

• BERF-1
• BFCOL1
• CACCC box-binding protein
• CLL-associated antigen KW-10
• HT-BETA
• pHZ-52
• Transcription factor ZBP-89
• ZBP89
• ZBP-89
• ZFP148zinc finger protein 148 (pHZ-52)
• Zinc finger DNA-binding protein 89
• zinc finger protein 148

Background

ZBP-89, also known as BFCOL1, BERF1 and ZNF 148, is a zinc finger transcription factor that is universally expressed. ZBP-89, a Kruppel-like repressor protein, is the silencer element binding factor for Vimentin. ZBP-89 has been shown to bind to GC-rich DNA elements in promoters for gastrin, ornithine decarboxylase and the cyclin-dependent kinase inhibitor p21 (also designated Cip1 or WAF1). ZBP-89 expression is induced by trans-retinoic acid or butyrate, which also induces terminal differentiation of colon cancer cells. ZBP-89 cooperates with histone acetyltransferase coactivator p300 in the regulation of p21, a cyclin-dependent kinase inhibitor whose associated gene is a target gene of p53. ZBP-89 also regulates cell proliferation, in part, through its ability to directly bind the p53 protein and retard its nuclear export. Elevated levels of ZBP-89 induce growth arrest and apoptosis in human gastrointestinal cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF148