ZNF148 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit ZNF148 Antibody - BSA Free (NBP2-94521) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 690-794 of human ZNF148 (NP_068799.2). SGDETNHASATSTQDFLDQVTSQKKAEAQPVHQAYQMSSFEQPFRAPYHGSRAGIATQFSTANGQVNLRGPGTSAEFSEFPLVNVNDNRAGMTSSPDATTGQTFG |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ZNF148 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:20 - 1:100
- Immunohistochemistry 1:50-1:100
- Immunohistochemistry-Paraffin
- Western Blot 1:500-1:1000
|
| Theoretical MW |
89 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for ZNF148 Antibody - BSA Free
Background
ZBP-89, also known as BFCOL1, BERF1 and ZNF 148, is a zinc finger transcription factor that is universally expressed. ZBP-89, a Kruppel-like repressor protein, is the silencer element binding factor for Vimentin. ZBP-89 has been shown to bind to GC-rich DNA elements in promoters for gastrin, ornithine decarboxylase and the cyclin-dependent kinase inhibitor p21 (also designated Cip1 or WAF1). ZBP-89 expression is induced by trans-retinoic acid or butyrate, which also induces terminal differentiation of colon cancer cells. ZBP-89 cooperates with histone acetyltransferase coactivator p300 in the regulation of p21, a cyclin-dependent kinase inhibitor whose associated gene is a target gene of p53. ZBP-89 also regulates cell proliferation, in part, through its ability to directly bind the p53 protein and retard its nuclear export. Elevated levels of ZBP-89 induce growth arrest and apoptosis in human gastrointestinal cells.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P
Publications for ZNF148 Antibody (NBP2-94521) (0)
There are no publications for ZNF148 Antibody (NBP2-94521).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ZNF148 Antibody (NBP2-94521) (0)
There are no reviews for ZNF148 Antibody (NBP2-94521).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ZNF148 Antibody (NBP2-94521) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ZNF148 Products
Blogs on ZNF148