MKKS Antibody

Images

 
Western Blot: MKKS Antibody [NBP1-92123] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: MKKS Antibody [NBP1-92123] - Immunofluorescent staining of human cell line U-2 OS shows localization to centrosome.
Immunohistochemistry-Paraffin: MKKS Antibody [NBP1-92123] - Staining of human urinary bladder.
Immunohistochemistry-Paraffin: MKKS Antibody [NBP1-92123] - Staining of human colon shows strong cytoplasmic and nuclear positivity in glandular cells.
Independent Antibodies: Immunohistochemistry-Paraffin: MKKS Antibody [NBP1-92123] - Staining of human colon, kidney, testis and urinary bladder using Anti-MKKS antibody NBP1-92123 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: MKKS Antibody [NBP1-92123] - Staining of human kidney.
Immunohistochemistry-Paraffin: MKKS Antibody [NBP1-92123] - Staining of human testis.
Immunohistochemistry-Paraffin: MKKS Antibody [NBP1-92123] - Staining of human colon.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

MKKS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KSTALKVALFCTTLSGDTSDTGEGTVVVSYGVSLENAVLDQLLNLGRQLISDHVDLVLCQKVIHPSLKQFLNMHRIIAIDRIGVTLMEPLTK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MKKS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MKKS Protein (NBP1-92123PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MKKS Antibody

  • Bardet-Biedl syndrome 6 protein
  • BBS6MKS
  • HMCS
  • KMS
  • McKusick-Kaufman syndrome
  • McKusick-Kaufman/Bardet-Biedl syndromes putative chaperonin

Background

MKKS encodes a protein with sequence similarity to the chaperonin family. The encoded protein may have a role in protein processing in limb, cardiac and reproductive system development. Mutations in this gene have been observed in patients with Bardet-Biedl syndrome type 6 and McKusick-Kaufman syndrome. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MKKS Antibody (NBP1-92123) (0)

There are no publications for MKKS Antibody (NBP1-92123).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MKKS Antibody (NBP1-92123) (0)

There are no reviews for MKKS Antibody (NBP1-92123). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MKKS Antibody (NBP1-92123) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MKKS Products

Research Areas for MKKS Antibody (NBP1-92123)

Find related products by research area.

Blogs on MKKS

There are no specific blogs for MKKS, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MKKS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MKKS