MKKS Antibody

Images

 
Western Blot: MKKS Antibody [NBP1-92123] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: MKKS Antibody [NBP1-92123] - Immunofluorescent staining of human cell line U-2 OS shows localization to centrosome.
Immunohistochemistry-Paraffin: MKKS Antibody [NBP1-92123] - Staining of human colon shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MKKS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KSTALKVALFCTTLSGDTSDTGEGTVVVSYGVSLENAVLDQLLNLGRQLISDHVDLVLCQKVIHPSLKQFLNMHRIIAIDRIGVTLMEPLTK
Specificity
Specificity of human MKKS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MKKS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MKKS Protein (NBP1-92123PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MKKS Antibody

  • Bardet-Biedl syndrome 6 protein
  • BBS6MKS
  • HMCS
  • KMS
  • McKusick-Kaufman syndrome
  • McKusick-Kaufman/Bardet-Biedl syndromes putative chaperonin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91695
Species: Hu
Applications: IHC, IHC-P
NBP1-86248
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88690
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46722
Species: Hu
Applications: IHC, IHC-P
NBP1-06590
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88688
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-32740
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88689
Species: Hu
Applications: WB, IHC, IHC-P
H00166379-B01P
Species: Hu, Mu
Applications: WB, ELISA
NBP1-84403
Species: Hu
Applications: IHC, IHC-P
NBP1-88691
Species: Hu
Applications: WB, IHC, IHC-P
NB100-86991
Species: Hu, Mu
Applications: WB, ICC/IF, IP, ICC, IF
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF6240
Species: Hu
Applications: WB, ELISA, IHC
NBP2-65899
Species: Hu
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB

Publications for MKKS Antibody (NBP1-92123) (0)

There are no publications for MKKS Antibody (NBP1-92123).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MKKS Antibody (NBP1-92123) (0)

There are no reviews for MKKS Antibody (NBP1-92123). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MKKS Antibody (NBP1-92123) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MKKS Products

Bioinformatics Tool for MKKS Antibody (NBP1-92123)

Discover related pathways, diseases and genes to MKKS Antibody (NBP1-92123). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MKKS Antibody (NBP1-92123)

Discover more about diseases related to MKKS Antibody (NBP1-92123).
 

Pathways for MKKS Antibody (NBP1-92123)

View related products by pathway.

PTMs for MKKS Antibody (NBP1-92123)

Learn more about PTMs related to MKKS Antibody (NBP1-92123).

Blogs on MKKS

There are no specific blogs for MKKS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MKKS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MKKS