Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6)


Western Blot: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - AKR1B10 monoclonal antibody (M01), clone 1A6 Analysis of AKR1B10 expression in HepG2.
Immunocytochemistry/ Immunofluorescence: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - Analysis of monoclonal antibody to AKR1B10 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - Analysis of monoclonal antibody to AKR1B10 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
Western Blot: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - Analysis of AKR1B10 expression in transfected 293T cell line by AKR1B10 monoclonal antibody (M01), clone 1A6.Lane 1: AKR1B10 transfected more
ELISA: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - Detection limit for recombinant GST tagged AKR1B10 is approximately 0.1ng/ml as a capture antibody.
Sandwich ELISA: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - Detection limit for recombinant GST tagged AKR1B10 is approximately 0.03ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary

Order Details

Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) Summary

AKR1B10 (NP_064695, 76 a.a. ~ 143 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWE
AKR1B10 - aldo-keto reductase family 1, member B10 (aldose reductase)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Read Publications using
H00057016-M01 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
In 1x PBS, pH 7.4
No Preservative
IgG purified


This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6)

  • AKR1B10
  • AKR1B11
  • AKR1B12
  • Aldo-keto Reductase 1B10
  • aldo-keto reductase family 1 member B10
  • aldo-keto reductase family 1, member B10 (aldose reductase)
  • aldo-keto reductase family 1, member B11 (aldose reductase-like)
  • AldoketoReductase 1B10
  • aldose reductase-like 1
  • aldose reductase-like peptide
  • Aldose reductase-like
  • Aldose reductase-related protein
  • ALDRLn
  • ARL1
  • ARL-1SI reductase
  • ARP
  • EC 1.1.1
  • EC 1.1.1.-
  • EC
  • hARP
  • HIS
  • HSI
  • MGC14103
  • Small intestine reductase


This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA

Publications for Aldo-keto Reductase 1B10/AKR1B10 Antibody (H00057016-M01)(13)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.

Filter By Application
All Applications
Filter By Species
All Species
Showing Publications 1 - 10 of 13. Show All 13 Publications.
Publications using H00057016-M01 Applications Species
Phadke G, Kaushal A, Tolan DR et al. Osmotic Nephrosis and Acute Kidney Injury Associated With SGLT2 Inhibitor Use: A Case Report Am. J. Kidney Dis. May 5 2020 [PMID: 32387022] (IHC, Human) IHC Human
Kitakaze T, Makiyama A, Samukawa Y et al. A physiological concentration of luteolin induces phase II drug-metabolizing enzymes through the ERK1/2 signaling pathway in HepG2 cells. Arch Biochem Biophys. 2019 Apr 02 [PMID: 30641047]
Berard AR, Coombs KM, Severini A. Quantification of the Host Response Proteome after Herpes Simplex 1 Virus infection. J Proteome Res. 2015 Apr 15 [PMID: 25815715]
Matkowskyj KA, Bai H, Liao J et al. Aldo-Ketoreductase Family 1 B10 (AKR1B10) as A Biomarker to Distinguish Hepatocellular Carcinoma from Benign Liver Lesions. Human Pathology(2013). 2014 Apr [PMID: 24656094]
Nelson AC, Pillay N, Henderson S et al. An integrated functional genomics approach identifies the regulatory network directed by brachyury (T) in chordoma. J Pathol. 2012 Jul 30 [PMID: 22847733]
Moriguchi H, Zhang Y, Mihara M, Sato C. A therapeutic method for the direct reprogramming of human liver cancer cells with only chemicals. Sci Rep. 2012 Feb 21 [PMID: 22355790]
Chung YT, Matkowskyj KA, Li H et al. Overexpression and oncogenic function of aldo-keto reductase family 1B10 (AKR1B10) in pancreatic carcinoma. Mod Pathol. 2012 Jan 06 [PMID: 22222635]
Schmitz KJ, Sotiropoulos GC, Baba HA et al. AKR1B10 expression is associated with less aggressive hepatocellular carcinoma: a clinicopathological study of 168 cases. Liver International. 2011 Mar 29 [PMID: 21645211]
Bains OS, Grigliatti TA, Reid RE, Riggs KW. Naturally occurring variants of human aldo-keto reductases with reduced in vitro metabolism of daunorubicin and doxorubicin. J Pharmacol Exp Ther. 2010 Sep 13 [PMID: 20837989]
Satow R, Shitashige M, Kanai Y et al. Combined functional genome survey of therapeutic targets for hepatocellular carcinoma. Clin Cancer Res 16(9):2518-28. 2010 May 1. [PMID: 20388846]
Show All 13 Publications.

Reviews for Aldo-keto Reductase 1B10/AKR1B10 Antibody (H00057016-M01) (0)

There are no reviews for Aldo-keto Reductase 1B10/AKR1B10 Antibody (H00057016-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Aldo-keto Reductase 1B10/AKR1B10 Antibody (H00057016-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Aldo-keto Reductase 1B10/AKR1B10 Products

Bioinformatics Tool for Aldo-keto Reductase 1B10/AKR1B10 Antibody (H00057016-M01)

Discover related pathways, diseases and genes to Aldo-keto Reductase 1B10/AKR1B10 Antibody (H00057016-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aldo-keto Reductase 1B10/AKR1B10 Antibody (H00057016-M01)

Discover more about diseases related to Aldo-keto Reductase 1B10/AKR1B10 Antibody (H00057016-M01).

Pathways for Aldo-keto Reductase 1B10/AKR1B10 Antibody (H00057016-M01)

View related products by pathway.

PTMs for Aldo-keto Reductase 1B10/AKR1B10 Antibody (H00057016-M01)

Learn more about PTMs related to Aldo-keto Reductase 1B10/AKR1B10 Antibody (H00057016-M01).

Blogs on Aldo-keto Reductase 1B10/AKR1B10

There are no specific blogs for Aldo-keto Reductase 1B10/AKR1B10, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) and receive a gift card or discount.


Gene Symbol AKR1B10