Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) - Azide and BSA Free

Images

 
Western Blot: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - AKR1B10 monoclonal antibody (M01), clone 1A6 Analysis of AKR1B10 expression in HepG2.
Immunocytochemistry/ Immunofluorescence: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - Analysis of monoclonal antibody to AKR1B10 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - Analysis of monoclonal antibody to AKR1B10 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
Western Blot: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - Analysis of AKR1B10 expression in transfected 293T cell line by AKR1B10 monoclonal antibody (M01), clone 1A6.Lane 1: AKR1B10 transfected ...read more
ELISA: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - Detection limit for recombinant GST tagged AKR1B10 is approximately 0.1ng/ml as a capture antibody.
Sandwich ELISA: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - Detection limit for recombinant GST tagged AKR1B10 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clone
1A6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) - Azide and BSA Free Summary

Description
Novus Biologicals Mouse Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) - Azide and BSA Free (H00057016-M01) is a monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. Anti-Aldo-keto Reductase 1B10/AKR1B10 Antibody: Cited in 13 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
AKR1B10 (NP_064695, 76 a.a. ~ 143 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWE
Specificity
AKR1B10 - aldo-keto reductase family 1, member B10 (aldose reductase)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AKR1B10
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Publications
Read Publications using
H00057016-M01 in the following applications:

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) - Azide and BSA Free

  • AKR1B10
  • AKR1B11
  • AKR1B12
  • Aldo-keto Reductase 1B10
  • aldo-keto reductase family 1 member B10
  • aldo-keto reductase family 1, member B10 (aldose reductase)
  • aldo-keto reductase family 1, member B11 (aldose reductase-like)
  • AldoketoReductase 1B10
  • aldose reductase-like 1
  • aldose reductase-like peptide
  • Aldose reductase-like
  • Aldose reductase-related protein
  • ALDRLn
  • ARL1
  • ARL-1SI reductase
  • ARP
  • EC 1.1.1
  • EC 1.1.1.-
  • EC 1.1.1.21
  • hARP
  • HIS
  • HSI
  • MGC14103
  • Small intestine reductase

Background

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010097-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NBP2-02164
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-90233
Species: Hu
Applications: IHC,  IHC-P, WB
H00000126-D01P
Species: Hu, Mu
Applications: WB
NBP2-00649
Species: Ca, Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-35880
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-62658
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-16424
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-30955
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF1444
Species: Mu
Applications: IHC, WB
NB300-996
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
AF-252-PB
Species: Hu
Applications: IHC, WB
NBP1-82512
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-14306
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-47477
Species: Hu, Rt
Applications: ELISA, IHC, WB
NBP2-15971
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC

Publications for Aldo-keto Reductase 1B10/AKR1B10 Antibody (H00057016-M01)(14)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IF/IHC.


Filter By Application
IF/IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species
Showing Publications 1 - 10 of 14. Show All 14 Publications.
Publications using H00057016-M01 Applications Species
Miika M, Terhi A, Sara K et al. A novel uterine leiomyoma subtype exhibits NRF2 activation and mutations in genes associated with neddylation of the Cullin 3-RING E3 ligase. Oncogenesis. 2022-09-07 [PMID: 36068196]
Kitakaze T, Makiyama A, Samukawa Y et al. A physiological concentration of luteolin induces phase II drug-metabolizing enzymes through the ERK1/2 signaling pathway in HepG2 cells. Arch Biochem Biophys. 2019-04-02 [PMID: 30641047]
Park SH, Kim JH, Ko E et al. Resistance to gefitinib and cross-resistance to irreversible EGFR-TKIs mediated by disruption of the Keap1-Nrf2 pathway in human lung cancer cells. FASEB J 2018-05-29 [PMID: 29812969]
Connor JP, Esbona K, Matkowskyj KA. et al. AKR1B10 Expression by Immunohistochemistry in Surgical Resections and Fine Needle Aspiration Cytology Material in Patients with Cystic Pancreatic Lesions; Potential for Improved Non-Operative Diagnosis. Hum Pathol 2017-10-24 [PMID: 29079172]
Berard AR, Coombs KM, Severini A. Quantification of the Host Response Proteome after Herpes Simplex 1 Virus infection. J Proteome Res. 2015-04-15 [PMID: 25815715]
Matkowskyj KA, Bai H, Liao J et al. Aldo-Ketoreductase Family 1 B10 (AKR1B10) as A Biomarker to Distinguish Hepatocellular Carcinoma from Benign Liver Lesions. Human Pathology(2013). 2014-04-01 [PMID: 24656094]
Nelson AC, Pillay N, Henderson S et al. An integrated functional genomics approach identifies the regulatory network directed by brachyury (T) in chordoma. J Pathol. 2012-07-30 [PMID: 22847733]
Moriguchi H, Zhang Y, Mihara M, Sato C. A therapeutic method for the direct reprogramming of human liver cancer cells with only chemicals. Sci Rep. 2012-02-21 [PMID: 22355790]
Chung YT, Matkowskyj KA, Li H et al. Overexpression and oncogenic function of aldo-keto reductase family 1B10 (AKR1B10) in pancreatic carcinoma. Mod Pathol. 2012-01-06 [PMID: 22222635]
Schmitz KJ, Sotiropoulos GC, Baba HA et al. AKR1B10 expression is associated with less aggressive hepatocellular carcinoma: a clinicopathological study of 168 cases. Liver International. 2011-03-29 [PMID: 21645211]
Show All 14 Publications.

Reviews for Aldo-keto Reductase 1B10/AKR1B10 Antibody (H00057016-M01) (0)

There are no reviews for Aldo-keto Reductase 1B10/AKR1B10 Antibody (H00057016-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Aldo-keto Reductase 1B10/AKR1B10 Antibody (H00057016-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aldo-keto Reductase 1B10/AKR1B10 Products

Research Areas for Aldo-keto Reductase 1B10/AKR1B10 Antibody (H00057016-M01)

Find related products by research area.

Blogs on Aldo-keto Reductase 1B10/AKR1B10

There are no specific blogs for Aldo-keto Reductase 1B10/AKR1B10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol AKR1B10
Entrez
OMIM
Uniprot