Western Blot: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - AKR1B10 monoclonal antibody (M01), clone 1A6 Analysis of AKR1B10 expression in HepG2.
Immunocytochemistry/ Immunofluorescence: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - Analysis of monoclonal antibody to AKR1B10 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - Analysis of monoclonal antibody to AKR1B10 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
Western Blot: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - Analysis of AKR1B10 expression in transfected 293T cell line by AKR1B10 monoclonal antibody (M01), clone 1A6.Lane 1: AKR1B10 transfected ...read more
ELISA: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - Detection limit for recombinant GST tagged AKR1B10 is approximately 0.1ng/ml as a capture antibody.
Sandwich ELISA: Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) [H00057016-M01] - Detection limit for recombinant GST tagged AKR1B10 is approximately 0.03ng/ml as a capture antibody.
AKR1B10 (NP_064695, 76 a.a. ~ 143 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWE
Specificity
AKR1B10 - aldo-keto reductase family 1, member B10 (aldose reductase)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AKR1B10
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Publications
Read Publications using H00057016-M01 in the following applications:
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6)
AKR1B10
AKR1B11
AKR1B12
Aldo-keto Reductase 1B10
aldo-keto reductase family 1 member B10
aldo-keto reductase family 1, member B10 (aldose reductase)
aldo-keto reductase family 1, member B11 (aldose reductase-like)
AldoketoReductase 1B10
aldose reductase-like 1
aldose reductase-like peptide
Aldose reductase-like
Aldose reductase-related protein
ALDRLn
ARL1
ARL-1SI reductase
ARP
EC 1.1.1
EC 1.1.1.-
EC 1.1.1.21
hARP
HIS
HSI
MGC14103
Small intestine reductase
Background
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Ahn KH, Kim SK, Lee JM et al. Proteomic Analysis of Bronchoalveolar Lavage Fluid Obtained from Rats Exposed to Formaldehyde. Journal of Health Science 2010-01-01
Reviews for Aldo-keto Reductase 1B10/AKR1B10 Antibody (H00057016-M01) (0)
There are no reviews for Aldo-keto Reductase 1B10/AKR1B10 Antibody (H00057016-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Bioinformatics Tool for Aldo-keto Reductase 1B10/AKR1B10 Antibody (H00057016-M01)
Discover related pathways, diseases and genes to Aldo-keto Reductase 1B10/AKR1B10 Antibody (H00057016-M01). Need help?
Read the Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Aldo-keto Reductase 1B10/AKR1B10 Antibody (H00057016-M01)
Discover more about diseases related to Aldo-keto Reductase 1B10/AKR1B10 Antibody (H00057016-M01).
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Aldo-keto Reductase 1B10/AKR1B10 Antibody (1A6) and receive a gift card or discount.