STAT6 Antibody

Images

 
Western Blot: STAT6 Antibody [NBP1-85345] - Analysis in human cell lines A-549 and U-251MG using Anti-STAT6 antibody. Corresponding STAT6 RNA-seq data are presented for the same cell lines. Loading control: Anti-PFN1.
Immunocytochemistry/ Immunofluorescence: STAT6 Antibody [NBP1-85345] - Staining of human cell line U-2 OS shows localization to nuclear membrane & cytosol.
Immunohistochemistry-Paraffin: STAT6 Antibody [NBP1-85345] - Staining of human urinary bladder shows strong cytoplasmic and nuclear positivity in urothelial cells.
Western Blot: STAT6 Antibody [NBP1-85345] - Analysis in human cell line Daudi.
Western Blot: STAT6 Antibody [NBP1-85345] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Simple Western: STAT6 Antibody [NBP1-85345] - Simple Western lane view shows a specific band for STAT6 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation ...read more
Simple Western: STAT6 Antibody [NBP1-85345] - Electropherogram image(s) of corresponding Simple Western lane view. STAT6 antibody was used at 1:20 dilution on RT-4 lysate(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
       

Orthogonal Strategies

 

Order Details

STAT6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMDLR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STAT6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:20
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
STAT6 Protein (NBP1-85345PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STAT6 Antibody

  • D12S1644
  • EC 2.4.1.227
  • EC 2.7.7.6
  • IL-4 Stat
  • IL-4-STAT
  • signal transducer and activator of transcription 6
  • signal transducer and activator of transcription 6, interleukin-4 induced
  • STAT, interleukin4-induced
  • STAT6
  • STAT6B
  • STAT6C
  • transcription factor IL-4 STAT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP2-00851
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-00622
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB500-470
Species: Hu
Applications: ELISA, Flow
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
AF2988
Species: Mu, Rt
Applications: WB
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-37737
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-85345
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for STAT6 Antibody (NBP1-85345) (0)

There are no publications for STAT6 Antibody (NBP1-85345).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STAT6 Antibody (NBP1-85345) (0)

There are no reviews for STAT6 Antibody (NBP1-85345). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for STAT6 Antibody (NBP1-85345) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STAT6 Products

Bioinformatics Tool for STAT6 Antibody (NBP1-85345)

Discover related pathways, diseases and genes to STAT6 Antibody (NBP1-85345). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STAT6 Antibody (NBP1-85345)

Discover more about diseases related to STAT6 Antibody (NBP1-85345).
 

Pathways for STAT6 Antibody (NBP1-85345)

View related products by pathway.

PTMs for STAT6 Antibody (NBP1-85345)

Learn more about PTMs related to STAT6 Antibody (NBP1-85345).
 

Research Areas for STAT6 Antibody (NBP1-85345)

Find related products by research area.

Blogs on STAT6

There are no specific blogs for STAT6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STAT6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STAT6
Entrez