STAT6 Antibody - BSA Free Summary
| Immunogen |
This STAT6 antibody was developed against Recombinant Protein corresponding to amino acids: VYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMDLR |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
STAT6 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
- Simple Western 1:20
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. See Simple Western Antibody Database for Simple Western validation: Tested in RT-4, separated by Size, antibody dilution of 1:20, apparent MW was 100 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for STAT6 Antibody - BSA Free
Background
Signal Transducer and Activator of Transcription 6 (STAT6) is a member of the Janus family tyrosine kinases (Jak)/ STAT signal transduction pathway and mediates cytokine signaling by IL 4 and IL-13 (1). STAT6 (predicted molecular weight 94kDa) has been found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL-4. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. STAT6 is tyrosine phosphorylated (Tyr641) in response to cellular interaction with IL-4. STAT6 mRNA has been detected in peripheral blood lymphocytes, colon, intestine, ovary, prostate, thymus, spleen, kidney, liver, lung and placenta. STAT6 is critically involved in Th2 and Th9 immune response (2). Loss of STAT6 impairs IL-4 mediated functions including Th2 helper T cell differentiation, expression of cell surface markers, T-cell proliferation, immunoglobulin class switching to IgE, and partial loss of IL-4 mediated proliferation. Diseases associated with STAT6 include malignant hemangiopericytoma and nut allergies.
References
1. Waqas, S. F. H., Ampem, G., & Roszer, T. (2019). Analysis of IL-4/STAT6 Signaling in Macrophages. Methods Mol Biol, 1966, 211-224. doi:10.1007/978-1-4939-9195-2_17
2. Goenka, S., & Kaplan, M. H. (2011). Transcriptional regulation by STAT6. Immunol Res, 50(1), 87-96. doi:10.1007/s12026-011-8205-2
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
Species: Mu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
Species: Sh
Applications: ELISA, IHC, IHC-Fr, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: Simple Western, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Ch, Mu
Applications: ELISA, IHC, Single-Cell Western, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, WB
Publications for STAT6 Antibody (NBP1-85345) (0)
There are no publications for STAT6 Antibody (NBP1-85345).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for STAT6 Antibody (NBP1-85345) (0)
There are no reviews for STAT6 Antibody (NBP1-85345).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for STAT6 Antibody (NBP1-85345) (0)