STAM2 Antibody

Images

 
Independent Antibodies: Western Blot: STAM2 Antibody [NBP1-83289] - Analysis using Anti-STAM2 antibody NBP1-83289 (A) shows similar pattern to independent antibody NBP1-83288 (B).
Immunohistochemistry-Paraffin: STAM2 Antibody [NBP1-83289] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Orthogonal Strategies: Immunohistochemistry-Paraffin: STAM2 Antibody [NBP1-83289] - Analysis in human testis and skeletal muscle tissues. Corresponding STAM2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: STAM2 Antibody [NBP1-83289] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: STAM2 Antibody [NBP1-83289] - Staining of human skeletal muscle shows very weak positivity in myocytes.
Immunohistochemistry-Paraffin: STAM2 Antibody [NBP1-83289] - Staining of human squamous epithelia shows moderate cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STAM2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EAPVYSVYSKLHPPAHYPPASSGVPMQTYPVQSHGGNYMGQSIHQVTVAQSYSLGPDQIGPLRSLPPNVNSSVTA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STAM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:10-1:20
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
STAM2 Protein (NBP1-83289PEP)
Publications
Read Publication using NBP1-83289.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STAM2 Antibody

  • DKFZp564C047
  • Hbp
  • Hrs-binding protein
  • HSE1 homolog
  • signal transducing adapter molecule 2
  • signal transducing adaptor molecule (SH3 domain and ITAM motif) 2
  • STAM-2
  • STAM2A
  • STAM2B
  • STAM-like protein containing SH3 and ITAM domains 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2200
Species: Hu
Applications: IP, WB
NBP1-76729
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
NB100-381
Species: Hu
Applications: ChIP, IP, WB
MAB5285
Species: Hu
Applications: Simple Western, WB
NBP3-09392
Species: Hu, Mu
Applications: WB
NB100-81898
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
H00009146-M01
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, KD, S-ELISA, WB
NBP1-88027
Species: Eq, Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
NBP2-46005
Species: Hu, Mu, Rt
Applications: IF, IHC, IHC-P, IP, PLA, WB
NBP2-83997
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-38514
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
H00006430-B01P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89490
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-90044
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-04382
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
D6050
Species: Hu
Applications: ELISA
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB

Publications for STAM2 Antibody (NBP1-83289)(1)

Reviews for STAM2 Antibody (NBP1-83289) (0)

There are no reviews for STAM2 Antibody (NBP1-83289). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STAM2 Antibody (NBP1-83289) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STAM2 Products

Bioinformatics Tool for STAM2 Antibody (NBP1-83289)

Discover related pathways, diseases and genes to STAM2 Antibody (NBP1-83289). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STAM2 Antibody (NBP1-83289)

Discover more about diseases related to STAM2 Antibody (NBP1-83289).
 

Pathways for STAM2 Antibody (NBP1-83289)

View related products by pathway.

PTMs for STAM2 Antibody (NBP1-83289)

Learn more about PTMs related to STAM2 Antibody (NBP1-83289).

Blogs on STAM2

There are no specific blogs for STAM2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STAM2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STAM2