STAM2 Antibody


Western Blot: STAM2 Antibody [NBP1-83289] - Analysis using Anti-STAM2 antibody NBP1-83289 (A) shows similar pattern to independent antibody NBP1-83288 (B).
Immunohistochemistry-Paraffin: STAM2 Antibody [NBP1-83289] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Orthogonal Strategies: Immunohistochemistry-Paraffin: STAM2 Antibody [NBP1-83289] - Analysis in human testis and skeletal muscle tissues. Corresponding STAM2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: STAM2 Antibody [NBP1-83289] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: STAM2 Antibody [NBP1-83289] - Staining of human skeletal muscle shows very weak positivity in myocytes.
Immunohistochemistry-Paraffin: STAM2 Antibody [NBP1-83289] - Staining of human squamous epithelia shows moderate cytoplasmic positivity in squamous epithelial cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

STAM2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: EAPVYSVYSKLHPPAHYPPASSGVPMQTYPVQSHGGNYMGQSIHQVTVAQSYSLGPDQIGPLRSLPPNVNSSVTA
Specificity of human STAM2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Read Publication using NBP1-83289.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for STAM2 Antibody

  • DKFZp564C047
  • Hbp
  • Hrs-binding protein
  • HSE1 homolog
  • signal transducing adapter molecule 2
  • signal transducing adaptor molecule (SH3 domain and ITAM motif) 2
  • STAM-2
  • STAM2A
  • STAM2B
  • STAM-like protein containing SH3 and ITAM domains 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Species: Hu
Applications: WB, ChIP, IP
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ca, Eq, Pm
Applications: WB
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, IHC, IHC-P

Publications for STAM2 Antibody (NBP1-83289)(1)

Reviews for STAM2 Antibody (NBP1-83289) (0)

There are no reviews for STAM2 Antibody (NBP1-83289). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STAM2 Antibody (NBP1-83289) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional STAM2 Products

Bioinformatics Tool for STAM2 Antibody (NBP1-83289)

Discover related pathways, diseases and genes to STAM2 Antibody (NBP1-83289). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STAM2 Antibody (NBP1-83289)

Discover more about diseases related to STAM2 Antibody (NBP1-83289).

Pathways for STAM2 Antibody (NBP1-83289)

View related products by pathway.

PTMs for STAM2 Antibody (NBP1-83289)

Learn more about PTMs related to STAM2 Antibody (NBP1-83289).

Blogs on STAM2

There are no specific blogs for STAM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our STAM2 Antibody and receive a gift card or discount.


Gene Symbol STAM2