HDLBP Antibody - Azide and BSA Free

Western Blot: HDLBP Antibody [NBP3-04382] - Analysis of extracts of various cell lines, using HDLBP antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

Immunocytochemistry/Immunofluorescence: HDLBP Antibody [NBP3-04382] - Analysis of L929 cells using HDLBP Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: HDLBP Antibody [NBP3-04382] - Paraffin-embedded mouse liver using HDLBP antibody at dilution of 1:100 (40x lens).

Immunohistochemistry-Paraffin: HDLBP Antibody [NBP3-04382] - Paraffin-embedded rat liver using HDLBP antibody at dilution of 1:100 (40x lens).

Immunohistochemistry-Paraffin: HDLBP Antibody [NBP3-04382] - Paraffin-embedded human liver using HDLBP antibody at dilution of 1:100 (40x lens).

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

HDLBP Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit HDLBP Antibody - Azide and BSA Free (NBP3-04382) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1035-1268 of human HDLBP (NP_976221.1). LERVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILRIVGELEQMVSEDVPLDHRVHARIIGARGKAIRKIMDEFKVDIRFPQSGAPDPNCVTVTGLPENVEEAIDHILNLEEEYLADVVDSEALQVYMKPPAHEEAKAPSRGFVVRDAPWTASSSEKAPDMSSSEEFPSFGAQVAPKTLPWGPKR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HDLBP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50-1:100
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for HDLBP Antibody - Azide and BSA Free

• HBPFLJ16432
• HDL-binding protein
• high density lipoprotein binding protein
• High density lipoprotein-binding protein
• PRO2900
• VGLvigilin

Background

HDL-binding protein 1 (HDLBP) is a novel protein that may be involved in the regulation of the delivery of fats to cells for energy and storage. Digested fats travel to the small intestine, where they are packaged into chylomicrons (particles filled with triglycerides). Chylomicrons then travel through the bloodstream and deliver triglycerides to tissues that are hungry for fuel or to adipose tissue for energy storage. Triglycerides are broken down or hydrolyzed by the enzyme lipoprotein lipase (LpL). The triglyceride breakdown products are then taken up and used by cells. HDLBP is the molecule in capillaries that facilitates the capture of chylomicrons and facilitates the interaction with LpL. It has been shown that fats in the bloodstream are not readily metabolized in the absence of HDLBP.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: HDLBP