ST3GAL4 Antibody - BSA Free

Immunohistochemistry-Paraffin: ST3GAL4 Antibody [NBP2-13390] - Staining of human ovary shows moderate cytoplasmic positivity in follicle cells.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human rectum shows strong cytoplasmic positivity in mast cell.

Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Staining of human ovary shows strong cytoplasmic positivity in follicle cells.

Staining of human skin shows no positivity in squamous epithelial cells as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ST3GAL4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ST3GAL4 Antibody - BSA Free (NBP2-13390) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: SREDRYIELFYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ST3GAL4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ST3GAL4 Protein (NBP2-13390PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ST3GAL4 Antibody - BSA Free

• Alpha 2,3-sialyltransferase IV
• Alpha 2,3-ST 4
• Beta-galactoside alpha-2,3-sialyltransferase 4
• CGS23
• CGS23FLJ46764
• EC 2.4.99
• EC 2.4.99.-
• EC 2.4.99.9
• FLJ11867
• gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase
• Gal-NAc 6S
• gal-NAc6S
• NANTA3
• NANTA3alpha-3-N-acetylneuraminyltransferase
• SAT3
• SAT-3
• sialyltransferase 4C (beta-galactosidase alpha-2,3-sialytransferase)
• sialyltransferase 4C (beta-galactoside alpha-2,3-sialytransferase)
• Sialyltransferase 4C
• SIAT4
• SIAT4C
• SIAT4-C
• SIAT4CCMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4
• ST3 beta-galactoside alpha-2,3-sialyltransferase 4
• ST3Gal IV
• ST3GAL4
• ST3GalA.2
• ST3GalIV
• ST-4
• STZSIAT4

Background

ST3GAL4 - ST3 beta-galactoside alpha-2,3-sialyltransferase 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ST3GAL4