ST3GAL4 Antibody

Images

 
Immunohistochemistry-Paraffin: ST3GAL4 Antibody [NBP2-13390] - Staining of human ovary shows moderate cytoplasmic positivity in follicle cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ST3GAL4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SREDRYIELFYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDY FWVKTPSAYE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ST3GAL4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ST3GAL4 Protein (NBP2-13390PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ST3GAL4 Antibody

  • Alpha 2,3-sialyltransferase IV
  • Alpha 2,3-ST 4
  • Beta-galactoside alpha-2,3-sialyltransferase 4
  • CGS23FLJ46764
  • EC 2.4.99
  • EC 2.4.99.-
  • EC 2.4.99.9
  • FLJ11867
  • gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase
  • gal-NAc6S
  • NANTA3alpha-3-N-acetylneuraminyltransferase
  • SAT3
  • SAT-3
  • sialyltransferase 4C (beta-galactosidase alpha-2,3-sialytransferase)
  • sialyltransferase 4C (beta-galactoside alpha-2,3-sialytransferase)
  • Sialyltransferase 4C
  • SIAT4-C
  • SIAT4CCMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4
  • ST3 beta-galactoside alpha-2,3-sialyltransferase 4
  • ST3Gal IV
  • ST3GalA.2
  • ST3GalIV
  • ST-4
  • STZSIAT4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6967
Species: Hu
Applications: WB
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-13390
Species: Hu
Applications: IHC, IHC-P

Publications for ST3GAL4 Antibody (NBP2-13390) (0)

There are no publications for ST3GAL4 Antibody (NBP2-13390).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST3GAL4 Antibody (NBP2-13390) (0)

There are no reviews for ST3GAL4 Antibody (NBP2-13390). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ST3GAL4 Antibody (NBP2-13390) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ST3GAL4 Products

Bioinformatics Tool for ST3GAL4 Antibody (NBP2-13390)

Discover related pathways, diseases and genes to ST3GAL4 Antibody (NBP2-13390). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ST3GAL4 Antibody (NBP2-13390)

Discover more about diseases related to ST3GAL4 Antibody (NBP2-13390).
 

Pathways for ST3GAL4 Antibody (NBP2-13390)

View related products by pathway.

PTMs for ST3GAL4 Antibody (NBP2-13390)

Learn more about PTMs related to ST3GAL4 Antibody (NBP2-13390).

Blogs on ST3GAL4

There are no specific blogs for ST3GAL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ST3GAL4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ST3GAL4