SSBP2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SSBP2 Antibody [NBP2-68872] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm & vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SSBP2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LGPQSDPWLSLQNYGGAMRPPLNALGGPGMPGMNMGPGGGR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SSBP2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
SSBP2 Recombinant Protein Antigen (NBP2-68872PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for SSBP2 Antibody

  • DKFZp686F03273
  • HSPC116
  • Sequence-specific single-stranded-DNA-binding protein 2
  • single-stranded DNA binding protein 2
  • single-stranded DNA-binding protein 2
  • SOSS-B2
  • SSDP2

Background

SSBP2 is a gene that codes for a protein with five isoforms, with lengths of 361, 298, 341, 331, and 339 amino acids and weights of approximately 38, 31, 36, 35, and 36 amino acids respectively. The protein coded by SSPB2 is involved in the maintenance of genome stability. Current research is being done on several diseases and disorders linked to this gene including anorexia nervosa, carcinoma, leukemia, myeloproliferative disorder, lissencephaly, hematopoiesis, esophagitis, prostate cancer, and prostatitis. SSBP2 has also been shown to have interactions with LDB1, IL36RN, TAL1, DYRK2, and LDB2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00023648-M01
Species: Hu, Mu
Applications: ELISA, S-ELISA, WB
NBP1-31362
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
H00009079-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-84843
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80720
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-P, KD, WB
DGD150
Species: Hu
Applications: ELISA
AF8221
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP2-01926
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
640-A3
Species: Mu
Applications: Bind
NBP2-01578
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-98143
Species: Hu
Applications: ELISA, ICC/IF, IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
MAB7555
Species: Hu
Applications: Simple Western, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
H00008805-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, PLA, WB
AF3176
Species: Hu
Applications: IHC, WB
NBP2-68872
Species: Hu
Applications: ICC/IF

Publications for SSBP2 Antibody (NBP2-68872) (0)

There are no publications for SSBP2 Antibody (NBP2-68872).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SSBP2 Antibody (NBP2-68872) (0)

There are no reviews for SSBP2 Antibody (NBP2-68872). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SSBP2 Antibody (NBP2-68872) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SSBP2 Products

Bioinformatics Tool for SSBP2 Antibody (NBP2-68872)

Discover related pathways, diseases and genes to SSBP2 Antibody (NBP2-68872). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SSBP2 Antibody (NBP2-68872)

Discover more about diseases related to SSBP2 Antibody (NBP2-68872).
 

Pathways for SSBP2 Antibody (NBP2-68872)

View related products by pathway.

PTMs for SSBP2 Antibody (NBP2-68872)

Learn more about PTMs related to SSBP2 Antibody (NBP2-68872).

Blogs on SSBP2

There are no specific blogs for SSBP2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SSBP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SSBP2