Home » SSBP2 » SSBP2 Antibodies » SSBP2 Antibody

SSBP2 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: SSBP2 Antibody [NBP2-68872] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm & vesicles.
Immunocytochemistry/ Immunofluorescence: SSBP2 Antibody [NBP2-68872] - Staining of human cell line SH-SY5Y shows localization to nucleoplasm & vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

SSBP2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LGPQSDPWLSLQNYGGAMRPPLNALGGPGMPGMNMGPGGGR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SSBP2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
SSBP2 Recombinant Protein Antigen (NBP2-68872PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for SSBP2 Antibody

  • DKFZp686F03273
  • HSPC116
  • Sequence-specific single-stranded-DNA-binding protein 2
  • single-stranded DNA binding protein 2
  • single-stranded DNA-binding protein 2
  • SOSS-B2
  • SSDP2

Background

SSBP2 is a gene that codes for a protein with five isoforms, with lengths of 361, 298, 341, 331, and 339 amino acids and weights of approximately 38, 31, 36, 35, and 36 amino acids respectively. The protein coded by SSPB2 is involved in the maintenance of genome stability. Current research is being done on several diseases and disorders linked to this gene including anorexia nervosa, carcinoma, leukemia, myeloproliferative disorder, lissencephaly, hematopoiesis, esophagitis, prostate cancer, and prostatitis. SSBP2 has also been shown to have interactions with LDB1, IL36RN, TAL1, DYRK2, and LDB2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SSBP3 Antibody
(3E6)
H00023648-M01
Sandwich ELISA: SSBP3 Antibody (3E6) [H00023648-M01] - Detection limit for recombinant GST tagged SSBP3 is approximately 0.3ng/ml as a capture antibody.
(2 Publications)
Species: Hu, Mu
Applications: ELISA, S-ELISA, WB
LDB1 Antibody
NBP1-31362
Knockout Validated: LDB1 Antibody [NBP1-31362] - Wild-type (WT) and LDB1 knockout (KO) HeLa cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with LDB1 antibody diluted at 1:1000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunohistochemistry-Paraffin: LDB1 Antibody [NBP1-31362] - Paraffin-embedded U87 Xenograft, using antibody at 1:100 dilution.
Western Blot: LDB1 Antibody [NBP1-31362] - Sample: 1000 ug 293T whole cell lysate/extract A. 20 ug 293T whole cell lysate/extract, B. Control with 2. 5 ug of preimmune rabbit IgGC. Immunoprecipitation of LDB1 protein by 2. 5 ug of LDB1 antibody diluted at 1:1000.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
LDB2 Antibody (1A3)
H00009079-M02
Immunocytochemistry/Immunofluorescence: LDB2 Antibody (1A3) [H00009079-M02] - Analysis of monoclonal antibody to LDB2 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: LDB2 Antibody (1A3) [H00009079-M02] - LDB2 monoclonal antibody (M02), clone 1A3 Analysis of LDB2 expression in IMR-32.
Western Blot: LDB2 Antibody (1A3) [H00009079-M02] - LDB2 monoclonal antibody (M02), clone 1A3. Analysis of LDB2 expression in HeLa.
Species: Hu
Applications: ELISA, ICC/IF, WB
PDLIM5 Antibody
NBP1-84843
Immunocytochemistry/Immunofluorescence: PDLIM5 Antibody [NBP1-84843] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane, cytosol & focal adhesion sites.
Immunohistochemistry-Paraffin: PDLIM5 Antibody [NBP1-84843] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: PDLIM5 Antibody [NBP1-84843] - Staining in human heart muscle and testis tissues.. Corresponding PDLIM5 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
SSBP1 Antibody
NBP1-80720
Immunohistochemistry-Paraffin: SSBP1 Antibody [NBP1-80720] - Analysis in human testis and pancreas tissues using HPA002866 antibody. Corresponding SSBP1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SSBP1 Antibody [NBP1-80720] - Staining of human cerebral cortex shows granular cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: SSBP1 Antibody [NBP1-80720] - Staining of human duodenum shows granular cytoplasmic positivity in glandular cells.
(5 Publications)
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-P, KD, WB
GDF-15 [HRP]
DGD150
(79 Publications)
Species: Hu
Applications: ELISA
XIAP Antibody
[Unconjugated]
AF8221
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, C2C12 mouse myoblast cell line, and PC‑12 rat adrenal pheochromocytoma cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat XIAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8221) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for XIAP at approximately 56 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and C2C12 mouse myoblast cell line, loaded at 0.2 mg/mL. A specific band was detected for XIAP at approximately 59 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat XIAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8221) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and XIAP knockout HeLa cell line (KO). PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat XIAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8221) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for XIAP at approximately 52 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockoutHeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(15 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
LIM1 Antibody
(OTI2D5)
NBP2-01926
Flow Cytometry: LIM1 Antibody (OTI2D5) [NBP2-01926] - Analysis of Jurkat cells, using anti-LHX1 antibody (Red) compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: LIM1 Antibody (OTI2D5) [NBP2-01926] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-LIM1 antibody, and then analyzed by flow cytometry.
Immunocytochemistry/Immunofluorescence: LIM1 Antibody (OTI2D5) [NBP2-01926] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY LIM1.
(4 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
ZNF645 Antibody
NBP2-21037
Western Blot: ZNF645 Antibody [NBP2-21037] - Sample (30 ug of whole cell lysate) A: MCF-7 10% SDS PAGE gel, diluted at 1:500.
Immunohistochemistry-Paraffin: ZNF645 Antibody [NBP2-21037] - Immunohistochemical analysis of paraffin-embedded GASTRIC CA, using antibody at 1:500 dilution.
Species: Hu
Applications: IHC, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on A549 cells with p53 (PAb240) NB200-103AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow (Intracellular): p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by APC-conjugated anti-mouse IgG secondary antibody F0101B.
(3 Reviews)
(34 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
EphA3
640-A3
EphA3
(6 Publications)
Species: Mu
Applications: Bind
OBFC2B Antibody
(OTI1E11)
NBP2-01578
Flow Cytometry: OBFC2B Antibody (1E11) [NBP2-01578] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-OBFC2B antibody, and then analyzed by flow cytometry.
Western Blot: OBFC2B Antibody (1E11) [NBP2-01578] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY OBFC2B (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-OBFC2B.
Immunohistochemistry-Paraffin: OBFC2B Antibody (1E11) [NBP2-01578] - Staining of paraffin-embedded Adenocarcinoma of Human endometrium tissue using anti-OBFC2B mouse monoclonal antibody.
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
MUL1 Antibody
(5H6.2D5) - BSA Free
NBP2-31361
Western Blot: MUL1 Antibody (5H6.2D5) [NBP2-31361] - WB detection of partial recombinant protein MUL1 by using MUL1 antibody (clone 5H6.2D5) at a concentration of 0.01 ug/ml.
Immunohistochemistry-Paraffin: MUL1 Antibody (5H6.2D5) [NBP2-31361] - IHC-P analysis of MUL1 protein in a section of normal prostate from human using 5 ug/ml concentration of MUL1 antibody (clone 5H6.2D5). Strong cytoplasmic staining was observed in the epithelial columnar and basal cells of prostate glands.
Immunohistochemistry-Paraffin: MUL1 Antibody (5H6.2D5) [NBP2-31361] - IHC-P analysis of MUL1 protein in a section of normal cardiac stomach from human using 5 ug/ml concentration of MUL1 antibody (clone 5H6.2D5). The cardiac glands showed distinct cytoplasmic staining, wherein, the parietal cells as well as the chief cells were found positive for MUL1.
Species: Hu
Applications: IHC, IHC-P, WB
SSBIP1/SOSS-C
Antibody
NBP2-98143
Immunocytochemistry/Immunofluorescence: SSBIP1/SOSS-C Antibody [NBP2-98143] - Immunofluorescence staining of SSBIP1/SOSS-C in U2OS cells. Cells were fixed with 4% PFA, permeabilzed with 0.1% Triton X-100 in PBS, blocked with 10% serum, and incubated with rabbit anti-Human SSBIP1/SOSS-C polyclonal antibody (dilution ratio 1:200) at 4C overnight. Then cells were stained with the Alexa Fluor(R)488-conjugated Goat Anti-rabbit IgG Secondary antibody (green). Positive staining was localized to Nucleus.
Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP2-98143] - Staining of human SSBIP1/SOSS-C in human brain with rabbit polyclonal antibody at 1:100 dilution.
Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP2-98143] - Staining of human SSBIP1/SOSS-C in human skin with rabbit polyclonal antibody at 1:100 dilution.
Species: Hu
Applications: ELISA, ICC/IF, IHC-P, WB
TRIM50 Antibody
NBP1-81988
Immunohistochemistry-Paraffin: TRIM50 Antibody [NBP1-81988] - Staining of human bone marrow shows strong cytoplasmic positivity in a subset of bone marrow poietic cells.
Species: Hu
Applications: IHC, IHC-P
TGIF1 Antibody
(790707)
MAB7555
Simple Western lane view shows lysates of HCT‑116 human colorectal carcinoma cell line, loaded at 0.5 mg/mL. A specific band was detected for TGIF1 at approximately 38 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human TGIF1 Monoclonal Antibody (Catalog # MAB7555). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows lysates of HCT‑116 human colorectal carcinoma cell line, JAR human choriocarcinoma cell line, and A549 human lung carcinoma cell line. PVDF membrane was probed with 0.1 µg/mL of Mouse Anti-Human TGIF1 Monoclonal Antibody (Catalog # MAB7555) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). Specific bands were detected for TGIF1 at approximately 32-35 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu
Applications: Simple Western, WB
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on Jurkat cells with c-Myc Antibody (9E10) NB600-302R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
Western Blot: c-Myc Antibody (9E10) [NB600-302] - CtIP is phosphorylated by CDKs at multiple sites. Myc-BRCA1 and/or HA-CtIP WT or indicated mutants were expressed in 293T cells and co-immunoprecipitation was performed. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pgen.1003277) licensed under a CC-BY licence.
(4 Reviews)
(38 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
TIF1 alpha
Antibody (2F2)
H00008805-M01
Immunocytochemistry/Immunofluorescence: TIF1 alpha Antibody (2F2) [H00008805-M01] - Analysis of monoclonal antibody to TRIM24 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: TIF1 alpha Antibody (2F2) [H00008805-M01] - Analysis of monoclonal antibody to TRIM24 on formalin-fixed paraffin-embedded human testis. Antibody concentration 6 ug/ml.
Immunoprecipitation: TIF1 alpha Antibody (2F2) [H00008805-M01] - Analysis of TRIM24 transfected lysate using anti-TRIM24 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TRIM24 MaxPab rabbit polyclonal antibody.
(4 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, PLA, WB
Carbonic Anhydrase
VB/CA5B Antibody
AF3176
Western blot shows lysates of human kidney (medulla) tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Carbonic Anhydrase VB/CA5B Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3176) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Carbonic Anhydrase VB/CA5B at approximately 32 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Carbonic Anhydrase VB/CA5B was detected in immersion fixed paraffin-embedded sections of human kidney using Goat Anti-Human Carbonic Anhydrase VB/CA5B Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3176) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to epithelial cells in convoluted tubules. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: IHC, WB
SSBP2 Antibody
NBP2-68872
SSBP2 Antibody
Species: Hu
Applications: ICC/IF

Publications for SSBP2 Antibody (NBP2-68872) (0)

There are no publications for SSBP2 Antibody (NBP2-68872).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SSBP2 Antibody (NBP2-68872) (0)

There are no reviews for SSBP2 Antibody (NBP2-68872). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SSBP2 Antibody (NBP2-68872) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SSBP2 Products

Bioinformatics Tool for SSBP2 Antibody (NBP2-68872)

Discover related pathways, diseases and genes to SSBP2 Antibody (NBP2-68872). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SSBP2 Antibody (NBP2-68872)

Discover more about diseases related to SSBP2 Antibody (NBP2-68872).
 

Pathways for SSBP2 Antibody (NBP2-68872)

View related products by pathway.

PTMs for SSBP2 Antibody (NBP2-68872)

Learn more about PTMs related to SSBP2 Antibody (NBP2-68872).

Blogs on SSBP2

There are no specific blogs for SSBP2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SSBP2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SSBP2