LDB1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: LDB1 Antibody [NBP1-85573] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: LDB1 Antibody [NBP1-85573] - Staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.

Immunohistochemistry-Paraffin: LDB1 Antibody [NBP1-85573] - Staining of human bone marrow shows strong nuclear positivity in a subset of hematopoietic cells.

Immunohistochemistry-Paraffin: LDB1 Antibody [NBP1-85573] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.

Immunohistochemistry-Paraffin: LDB1 Antibody [NBP1-85573] - Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.

Analysis in human cell line SH-SY5Y.

ChIP-Exo-Seq composite graph for Anti-LDB1 (NBP1-85573) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LDB1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit LDB1 Antibody - BSA Free (NBP1-85573) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-LDB1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MLDRDVGPTPMYPPTYLEPGIGRHTPYGNQTDYRIFELNKRLQNWTEECDNLW
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LDB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  LDB1 Protein (NBP1-85573PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for LDB1 Antibody - BSA Free

• carboxy terminal LIM domain protein 2
• Carboxyl-terminal LIM domain-binding protein 2
• CLIM-2
• CLIM2hLdb1
• LDB-1
• LIM domain binding 1
• LIM domain-binding factor-1
• LIM domain-binding protein 1
• NLILIM domain-binding factor CLIM2
• Nuclear LIM interactor

Background

LDB1 binds to the LIM domain of a wide variety of LIM domain-containing transcription factors. May regulate the transcriptional activity of LIM-containing proteins by determining specific partner interactions. May play a role in the development of motor neuron

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LDB1 Antibody (NBP1-85573)(2)

Publications using NBP1-85573

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]
• Li A, Ponten F, dos Remedios CG. The interactome of LIM domain proteins: the contributions of LIM domain proteins to heart failure and heart development. Proteomics 2012-01-01 [PMID: 22253135]

Bioinformatics

• Gene Symbol: LDB1