SSBP1 Antibody

Immunohistochemistry-Paraffin: SSBP1 Antibody [NBP1-80720] - Analysis in human testis and pancreas tissues using HPA002866 antibody. Corresponding SSBP1 RNA-seq data are presented for the same tissues.

Western Blot: SSBP1 Antibody [NBP1-80720] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-SSBP1 antibody. Remaining relative intensity is presented. Loading control: anti-PPIB.

Immunocytochemistry/Immunofluorescence: SSBP1 Antibody [NBP1-80720] - Mitochondrial components segregate into MVBs and are secreted in exosomes. Confocal co-localization analysis in HEK293 cells treated with FCCP (4 h) and stained with SSBP1 (red), EEA1 and CD63 (green). Bar, 10 um. Graph shows means for Mander's co-localization coefficient for SSBP1 and EEA1 or CD63 (n = 3). t-test: ***P-value < 0.0001. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-018-05077-9), licensed under a CC-BY license.

Immunohistochemistry-Paraffin: SSBP1 Antibody [NBP1-80720] - Staining of human testis shows positivity in cells in seminiferous ducts.

Western Blot: SSBP1 Antibody [NBP1-80720] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: SSBP1 Antibody [NBP1-80720] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SSBP1 Antibody [NBP1-80720] - Staining of human cerebral cortex shows granular cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: SSBP1 Antibody [NBP1-80720] - Staining of human duodenum shows granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: SSBP1 Antibody [NBP1-80720] - Staining of human pancreas shows weak granular cytoplasmic positivity in exocrine glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, WB, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SSBP1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKE
• Marker: Mitochondria Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SSBP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunoblotting
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. ICC/IF and WB reported in scientific literature (PMID: 25695250). Use in immunoblotting reported in scientific literature (PMID: 31698204).
• Control Peptide:

  SSBP1 Protein (NBP1-80720PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25695250)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SSBP1 Antibody

• mitochondrial
• MtSSB
• single-stranded DNA binding protein 1
• SSBP1

Background

The single-stranded-DNA-binding proteins (SSBs) are essential for DNA function in prokaryotic and eukaryotic cells, mitochondria, phages and viruses. Mitochondrial single-stranded DNA-binding protein (mtSSB or SSBP1) is necessary for mtDNA replication. SSBP1 is a homotetramer that binds preferentially and cooperatively to single-stranded DNA. It is localized to the mitochondria in normal and neoplastic human tissue of different origin, function, and differentiation, and is likely involved in mitochondrial DNA replication.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SSBP1 Antibody (NBP1-80720)(6)

Publications using NBP1-80720

• Atzori MG, Ceci C, Ruffini F Et al. The Anti-Vascular Endothelial Growth Factor Receptor 1 (VEGFR-1) D16F7 Monoclonal Antibody Inhibits Melanoma Adhesion to Soluble VEGFR-1 and Tissue Invasion in Response to Placenta Growth Factor Cancers (Basel) 2022-11-26 [PMID: 36428669] (IHC-P)
  
  Details:
  Citation using the HRP version of this antibody.
• Liu H, He Z, April SL et al. Biochemical re-programming of human dermal stem cells to neurons by increasing mitochondrial membrane potential Cell Death Differ. 2018-08-28 [PMID: 30154448] (ICC/IF, Human)
• Zurita Rendon O, Shoubridge E. LONP1 is required for maturation of a subset of mitochondrial proteins and its loss elicits an integrated stress response bioRxiv 2018-04-23 [PMID: 30061372] (IB, Human)
• Torralba D, Baixauli F, Villarroya-Beltri C et al. Priming of dendritic cells by DNA-containing extracellular vesicles from activated T cells through antigen-driven contacts. Nat Commun 2018-07-09 [PMID: 29985392] (ICC/IF, Human)
• Rajala N, Hensen F, Wessels HJ et al. Whole Cell Formaldehyde Cross-Linking Simplifies Purification of Mitochondrial Nucleoids and Associated Proteins Involved in Mitochondrial Gene Expression. PLoS One 2015-01-01 [PMID: 25695250] (WB)
• Nicolas A, Alazard-Dany N, Biollay C et al. Identification of rep-associated factors in herpes simplex virus type 1-induced adeno-associated virus type 2 replication compartments. J Virol 2010-09-01 [PMID: 20573815]

Bioinformatics

• Gene Symbol: SSBP1
• Entrez:
  • 6742(Human)
• Uniprot:
  • Q04837()
  • Q04837()
  • Q04837()
  • Q04837()