SSBP1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: SSBP1 Antibody [NBP1-80720] - Analysis in human testis and pancreas tissues using HPA002866 antibody. Corresponding SSBP1 RNA-seq data are presented for the ...read more
Genetic Strategies: Western Blot: SSBP1 Antibody [NBP1-80720] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-SSBP1 antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: SSBP1 Antibody [NBP1-80720] - Mitochondrial components segregate into MVBs and are secreted in exosomes. Confocal co-localization analysis in HEK293 cells treated with FCCP (4 h) ...read more
Immunohistochemistry-Paraffin: SSBP1 Antibody [NBP1-80720] - Staining of human testis shows positivity in cells in seminiferous ducts.
Western Blot: SSBP1 Antibody [NBP1-80720] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: SSBP1 Antibody [NBP1-80720] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SSBP1 Antibody [NBP1-80720] - Staining of human cerebral cortex shows granular cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: SSBP1 Antibody [NBP1-80720] - Staining of human duodenum shows granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SSBP1 Antibody [NBP1-80720] - Staining of human pancreas shows weak granular cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SSBP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKE
Marker
Mitochondria Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SSBP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunoblotting
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. ICC/IF and WB reported in scientific literature (PMID: 25695250). Use in immunoblotting reported in scientific literature (PMID: 31698204).
Control Peptide
SSBP1 Protein (NBP1-80720PEP)
Publications
Read Publications using
NBP1-80720 in the following applications:

  • IB
    1 publication
  • 2 publications
  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25695250)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SSBP1 Antibody

  • mitochondrial
  • MtSSB
  • single-stranded DNA binding protein 1
  • SSBP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67569
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-58327
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-71648
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, KO, Simple Western, WB
NBP2-92873
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00007001-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP1-88263
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-48002
Species: Ca, Hu, Pm, Pm
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-01578
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-98143
Species: Hu
Applications: ELISA, ICC/IF, IHC-P, WB
H00023648-M01
Species: Hu, Mu
Applications: ELISA, S-ELISA, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP1-19091
Species: Hu, Mu
Applications: IP, WB
NB100-104
Species: Ca, Hu, Ma, Mu, Rt
Applications: ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, WB
NB100-116
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
NBP1-52300
Species: Hu, Mu
Applications: ICC, ICC/IF, IHC, IHC-P, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-17937
Species: Hu
Applications: ICC/IF, WB
MAB6534
Species: Hu
Applications: ELISA, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80720
Species: Hu, Mu, Rt
Applications: WB, IB, ICC/IF, IHC, IHC-P, KD

Publications for SSBP1 Antibody (NBP1-80720)(5)

Reviews for SSBP1 Antibody (NBP1-80720) (0)

There are no reviews for SSBP1 Antibody (NBP1-80720). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SSBP1 Antibody (NBP1-80720) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SSBP1 Products

Bioinformatics Tool for SSBP1 Antibody (NBP1-80720)

Discover related pathways, diseases and genes to SSBP1 Antibody (NBP1-80720). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SSBP1 Antibody (NBP1-80720)

Discover more about diseases related to SSBP1 Antibody (NBP1-80720).
 

Pathways for SSBP1 Antibody (NBP1-80720)

View related products by pathway.

PTMs for SSBP1 Antibody (NBP1-80720)

Learn more about PTMs related to SSBP1 Antibody (NBP1-80720).
 

Research Areas for SSBP1 Antibody (NBP1-80720)

Find related products by research area.

Blogs on SSBP1

There are no specific blogs for SSBP1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SSBP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SSBP1
Entrez
Uniprot