SSBP1 Antibody - BSA Free

Western Blot: SSBP1 Antibody [NBP1-80720] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-SSBP1 antibody. Remaining relative intensity is presented. Loading control: anti-PPIB.

SSBP1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80720-img0023.jpg

Western Blot: SSBP1 Antibody [NBP1-80720] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: SSBP1 Antibody [NBP1-80720] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.

Analysis in human testis and pancreas tissues. Corresponding RNA-seq data are presented for the same tissues.

Staining of human testis shows positivity in cells in seminiferous ducts.

Staining of human pancreas shows weak granular cytoplasmic positivity in exocrine glandular cells.

Staining of human cerebral cortex shows granular cytoplasmic positivity in neurons.

Staining of human duodenum shows granular cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SSBP1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKE
• Marker: Mitochondria Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SSBP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SSBP1 Protein (NBP1-80720PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SSBP1 Antibody - BSA Free

• mitochondrial
• MtSSB
• single-stranded DNA binding protein 1
• SSBP1

Background

The single-stranded-DNA-binding proteins (SSBs) are essential for DNA function in prokaryotic and eukaryotic cells, mitochondria, phages and viruses. Mitochondrial single-stranded DNA-binding protein (mtSSB or SSBP1) is necessary for mtDNA replication. SSBP1 is a homotetramer that binds preferentially and cooperatively to single-stranded DNA. It is localized to the mitochondria in normal and neoplastic human tissue of different origin, function, and differentiation, and is likely involved in mitochondrial DNA replication.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SSBP1 Antibody (NBP1-80720)(7)

Publications using NBP1-80720

• Atzori MG, Ceci C, Ruffini F Et al. The Anti-Vascular Endothelial Growth Factor Receptor 1 (VEGFR-1) D16F7 Monoclonal Antibody Inhibits Melanoma Adhesion to Soluble VEGFR-1 and Tissue Invasion in Response to Placenta Growth Factor Cancers (Basel) 2022-11-26 [PMID: 36428669] (IHC-P)
  
  Details:
  Citation using the HRP version of this antibody.
• Tian HP, Sun YH, He L et al. Single-Stranded DNA-Binding Protein 1 Abrogates Cardiac Fibroblast Proliferation and Collagen Expression Induced by Angiotensin II. Int Heart J. 2018-10-25 [PMID: 30369577]
• Liu H, He Z, April SL et al. Biochemical re-programming of human dermal stem cells to neurons by increasing mitochondrial membrane potential Cell Death Differ. 2018-08-28 [PMID: 30154448] (ICC/IF, Human)
• Zurita Rendon O, Shoubridge E. LONP1 is required for maturation of a subset of mitochondrial proteins and its loss elicits an integrated stress response bioRxiv 2018-04-23 [PMID: 30061372] (IB, Human)
• Torralba D, Baixauli F, Villarroya-Beltri C et al. Priming of dendritic cells by DNA-containing extracellular vesicles from activated T cells through antigen-driven contacts. Nat Commun 2018-07-09 [PMID: 29985392] (ICC/IF, Human)
• Rajala N, Hensen F, Wessels HJ et al. Whole Cell Formaldehyde Cross-Linking Simplifies Purification of Mitochondrial Nucleoids and Associated Proteins Involved in Mitochondrial Gene Expression. PLoS One 2015-01-01 [PMID: 25695250] (WB)
• Nicolas A, Alazard-Dany N, Biollay C et al. Identification of rep-associated factors in herpes simplex virus type 1-induced adeno-associated virus type 2 replication compartments. J Virol 2010-09-01 [PMID: 20573815]

Bioinformatics

• Gene Symbol: SSBP1
• Entrez:
  • 6742(Human)
• Uniprot:
  • Q04837()
  • Q04837()
  • Q04837()
  • Q04837()