SSBP3 Antibody (3E6)

Images

 
Sandwich ELISA: SSBP3 Antibody (3E6) [H00023648-M01] - Detection limit for recombinant GST tagged SSBP3 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3E6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SSBP3 Antibody (3E6) Summary

Immunogen
SSBP3 (NP_060540, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDYSAAAAPSPVL
Specificity
SSBP3 - single stranded DNA binding protein 3
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SSBP3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Control
SSBP3 Knockout HeLa Cell Lysate
Publications
Read Publications using H00023648-M01.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SSBP3 Antibody (3E6)

  • CSDP
  • FLJ10355
  • single stranded DNA binding protein 3
  • SSDP1Sequence-specific single-stranded-DNA-binding protein
  • SSDPsingle-stranded DNA-binding protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31362
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00023635-B01P
Species: Hu
Applications: WB, ICC/IF
NB600-480
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP2-01926
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-80720
Species: Hu, Mu, Rt
Applications: WB, IB, ICC/IF, IHC, IHC-P, KD
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-92773
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-01578
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-84382
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-84228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NBP2-75440
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-97572
Species: Hu, Mu, Rt, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, In vivo, KD
NBP1-33757
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
AF1979
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
H00023648-M01
Species: Hu, Mu
Applications: WB, ELISA, S-ELISA

Publications for SSBP3 Antibody (H00023648-M01)(2)

Reviews for SSBP3 Antibody (H00023648-M01) (0)

There are no reviews for SSBP3 Antibody (H00023648-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SSBP3 Antibody (H00023648-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SSBP3 Products

Bioinformatics Tool for SSBP3 Antibody (H00023648-M01)

Discover related pathways, diseases and genes to SSBP3 Antibody (H00023648-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SSBP3 Antibody (H00023648-M01)

Discover more about diseases related to SSBP3 Antibody (H00023648-M01).
 

Pathways for SSBP3 Antibody (H00023648-M01)

View related products by pathway.

PTMs for SSBP3 Antibody (H00023648-M01)

Learn more about PTMs related to SSBP3 Antibody (H00023648-M01).

Blogs on SSBP3

There are no specific blogs for SSBP3, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SSBP3 Antibody (3E6) and receive a gift card or discount.

Bioinformatics

Gene Symbol SSBP3
Entrez
OMIM
Uniprot